KEGG   Aspergillus oryzae: AOR_1_946074Help
Entry
AOR_1_946074      CDS       T01018                                 

Gene name
AO090038000558
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aor  Aspergillus oryzae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOR_1_946074 (AO090038000558)
   00052 Galactose metabolism
    AOR_1_946074 (AO090038000558)
   00500 Starch and sucrose metabolism
    AOR_1_946074 (AO090038000558)
   00520 Amino sugar and nucleotide sugar metabolism
    AOR_1_946074 (AO090038000558)
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AOR_1_946074 (AO090038000558)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 521 aa AA seqDB search
MAAKALPTHLRAPATETSNAGSFGKHHGKSQSHMAFENASTSVAASQMRNALNALSETVP
DPQERKRFEAEMDNFFALFRRFLNDKAKGNEVNWDRIAPPQPSQVVNYESLGSEASVEFL
NKLAVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTFNVNVPFVLMNSF
NTDQDTQSIIKKYQGHNVDILTFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFE
SLYNSGTLDKLLERGVEYIFLSNADNLGAVVDLRILQHMVDTESEYIMELTDKTKADVKG
GTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMSLRAIKRVVEENELEMEI
IANEKSIPADKKGDADQAIYQLETAVGAAIRHFKNGHGVNVPRRRFLPVKTCSDLLLVKS
DLYRLEHGQLVMDPNRFGGVPVIKLGSDFKKVSDFQKHIPSIPRIVELDHLTITGAVNLG
RNVTLKGTVIIVATEGSTIDVPPGSVLENCVVQGSLRILEH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaagctttgcctacccacctcagagctccagccacggaaacctcaaacgct
ggctctttcggcaagcaccacggaaagtctcagtctcacatggcgttcgagaatgcatcg
accagcgttgctgcttctcagatgcgtaatgctctgaatgccctctcagagaccgtccct
gatcctcaggagcgcaagcgcttcgaggctgagatggacaacttcttcgccctcttccgc
agatttctgaacgacaaggctaagggcaacgaagtgaactgggaccgcattgctccaccc
cagccttcccaggtcgttaactatgagagcttgggcagcgaggcctcggttgagttcctg
aacaagttggctgttgttaagctgaacggtggcttgggtacttccatgggttgcgttggc
cccaagtcagtcattgaggtccgtgagggcatgtccttcctggatctgtccgttcgccag
atcgagcacctgaaccgcactttcaacgtcaacgttcccttcgtcctgatgaactccttc
aacaccgaccaggacactcagtccatcatcaagaaataccagggccacaacgttgatatc
cttaccttcaaccagtctcgctacccccgtatcatcaaggactctcttctccccgctcct
aagagctttgatgcacctctgcaggactggtatcccccaggccatggtgatgtctttgag
tccctgtacaactctggcactcttgacaagctcttggagcgtggtgtggagtacatcttc
ctgtccaacgccgacaacttgggtgctgtggtcgaccttcgcatcttgcagcacatggtt
gataccgagtctgagtacatcatggaattgactgataagaccaaggccgatgtgaagggt
ggtactatcatcgactacgagggcaaggctcgtctcttggaaatcgctcaggttcctaag
gagcacgtcaacgagttcaagtctatcaagaagttcaagtacttcaacacgaacaacatc
tggatgagcctccgcgctatcaagcgtgttgttgaggagaacgagcttgagatggagatc
atcgccaacgagaagtcgatccccgctgacaagaagggtgacgccgaccaggccatttat
cagcttgagaccgctgttggtgccgctatccgtcacttcaagaacggccacggtgtgaac
gtccctcgtcgccgcttcctgcccgtgaagacatgctccgatctcttgctggtcaagtcg
gatctttaccgtctggagcacggtcagttggtcatggaccctaaccgcttcggtggtgtt
cctgtgatcaagcttggatccgatttcaagaaggtttcggatttccagaagcacatcccc
agcatcccccgtatcgttgagctcgaccacctgacgatcaccggtgccgtcaacctgggt
cgcaatgttactctgaagggcacagtcatcattgtcgccacggagggtagcaccatcgat
gtgcctcctggatcggtactggagaactgtgttgtccagggaagcttgcgtatcctggag
cattaa

DBGET integrated database retrieval system