KEGG   Aspergillus oryzae: AOR_1_970144Help
Entry
AOR_1_970144      CDS       T01018                                 

Gene name
AO090023000559
Definition
carboxylesterase
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
aor  Aspergillus oryzae
Brite
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AOR_1_970144 (AO090023000559)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     AOR_1_970144 (AO090023000559)
    3.1.1.84  cocaine esterase
     AOR_1_970144 (AO090023000559)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MASHLSKSLASLAVTAAFAQAQLWDQTIQTNYGPVQGFKYFNESTLEKYFGVSESNVTAF
LGIPFAADTGYQNRWKPPQPREPWNETLKATDFGPACPSNYASNISEDCLSLNLWTNAGS
ADAKLPVMVWNQGSDETSNDAWWYGGGMALKDVILITFNRRDDAFGYLAHPELNAEGLQL
TGHNTSGNYGVLDQLEVLKWVQKNIAKFGGDPDRVVVAGQSFGSSQVYHAVNSPLFKGYF
HGGISESGIRYPYDPLLAGLATSYVNMSAAITHGVNYTTFHNVSSIKELRTLSMEELLIG
SQDRVNDTWIDPITALSAGYPLIFKPVLDDYVLPSTYLETLINGPANDVPVITGNTKDES
GASTTTDYTVGEYESYSTLKYGNLSSRYFQLYPDHGNASTVDRAWNAAARDTSLIGSWAY
ATDWYKSASSSFYTYYWTHAPPGQDQGAFHQSEIMYALNALYANADKYPFTQQDYAIQEK
MSAYWANFAKTLDPNEGGSYTGSGSLPRWSPNSANGTQVVMELGNAFGNVPIAKKVQVEL
IMEWFHQQTPY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcatttgtcaaagagcctagcctcactggccgtgaccgctgcgtttgcccaa
gctcagctctgggatcagaccatccagacgaattacggtcccgtccagggctttaagtat
ttcaacgagtctaccctcgagaaatacttcggtgtctccgagtccaacgtgacagccttt
ttgggtatcccgtttgctgcggacactgggtatcaaaaccgctggaagccaccacagccc
cgtgagccctggaatgaaaccctgaaagcgacggactttggtcctgcctgtcccagtaac
tacgcatccaatatcagcgaagactgcctcagtctgaacctctggaccaatgccggctct
gcggacgccaagctccctgttatggtctggaaccagggctctgacgagaccagcaatgat
gcctggtggtacggcggtggaatggccttgaaggacgtcatcctcattaccttcaaccgt
cgcgacgatgcattcggttacctcgctcatcctgagctcaacgccgaaggtctccagctg
accggtcacaatacatctggaaactatggtgtcctcgaccagctcgaggtcctcaaatgg
gtccagaaaaacatcgccaagtttggtggtgatccggaccgcgtagtcgtcgctggccag
tctttcggttcttcccaggtctatcatgccgtcaatagccctttgttcaaggggtacttc
catggcggtatctctgagtcaggtatcaggtatccatacgatcctttgcttgcaggcctc
gcgacctcttacgtcaatatgtccgctgccatcacgcacggtgtcaactatactaccttc
cacaatgtctccagcatcaaggaactgcgcacgctttccatggaggaactcctgattggc
tctcaggaccgcgtcaacgacacatggattgatccaatcaccgcactttctgctggctac
cctctcattttcaagcccgtcctagacgactacgtccttccctccacatacctggagaca
cttatcaacggccccgcgaacgacgtccccgtcataacaggcaacaccaaagacgagtca
ggcgcctcaacaaccaccgactacaccgtaggagaatacgagtcctattccactctcaaa
tatggtaatctatccagccgttatttccagctataccccgaccacggcaacgcaagcacc
gtagatagagcttggaacgcagctgcccgcgatacctccctcattggctcctgggcctac
gccaccgactggtacaagtccgcctcctcctcgttctacacctactactggacccacgcc
ccaccaggccaagaccagggtgccttccaccagtctgaaatcatgtatgcactgaatgct
ctctacgccaatgccgataaataccctttcactcagcaggactatgccatccaggagaag
atgtctgcctactgggctaactttgcaaagacgctcgatcccaacgagggtggatcttac
actggcagcggctcgctgccgcgctggagccccaacagcgccaatggtacccaggttgtc
atggagctcggcaatgcttttggaaacgtccccattgccaagaaggttcaggtggagctc
attatggagtggttccatcagcaaactccgtactaa

DBGET integrated database retrieval system