KEGG   Aspergillus oryzae: AOR_1_976194Help
Entry
AOR_1_976194      CDS       T01018                                 

Gene name
AO090012000557
Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aor  Aspergillus oryzae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AOR_1_976194 (AO090012000557)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AOR_1_976194 (AO090012000557)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AOR_1_976194 (AO090012000557)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1145 aa AA seqDB search
MAYAATSSASTVNGDARSSLKLTASSSNPPKLHHVITSIPPAPNPSSAPSYTSSLTTTPN
SLRPAYFPSNASSPSGTPLQIATDGLRGRIPPFPAIPSTTFELGESVMAVPGNAPASGSG
DAVISNSKGPGLMRRISRGAANKLTRRRQSASHNEKRDRSSGPVTMRRRSDSKTGSQNGR
DNALESSNEEDSNDALDSLGVWCGSESSSLPNESFMAASRHTGTIAPKIDSAIQRGTVLT
KVTKKRRKQVRFFLDLDAGKVYWDVSNPAKRFYIDDIKEIRVGVDARNYREEHQIPQDTE
NRWFTIVIADDERSKGRTVKTLHLIAPNTPILELWTTTLEHISRYRIGLMAGLAGSGQSE
AVLKAHWQREMSRLFPHGTRSAEQGSLDFGAVESICRSLHINCSKNMLRAQFSKADSDVN
GKLNFSQFQNFVARLKERKDVKEIFKDSATDAKAGLSVDEFLKFLRNIQNENVDSDRSYW
VSVFDKCVRKSKSRVPSIPEFEEEQVPRMDLDAFSSFLASPWNGLYASRAPQSRFDRPLN
EYFISSSHNTYLLGRQVAGASSTEAYISALQKGCRCVEIDCWDGADGRPIVSHGRTMTTS
VLFADCITVINRYAFITTDFPLILSLEVHCNPEQQLAMVKIMKDTFKDQLVLEPLLTNSF
VLPSPEELKGRILVKVKTCDELQEGVRQEPVGTFAVHGRKRSASSPFIRPTASESSAITS
LPPLSSPPTLGLETVGSFLTQDRRSFTTTSISSAAEESDGALATIRKEKKRRQKSKITKP
LSDLGVYTRGYKWHSFSSAESQRYNHVYSFAERSFEGICRDAENKALFEKHNRKYLTRVY
PSGFRLRSSNFDPLKFWRRGVQMAALNWQTYDIGMQMNQAMFAAGSDRTGYVLKPESLRA
LCPADEEKTKATEWKLVRFSVDVISAQQLPRPRSIGPDDNINPYVEIEMFSADDRGQSFV
YGEGGMNASARNGMSGIGFPHRRRTKIEQSNGYSPIFNDRFRLSLETKYPDLVFVRWTIW
SSQDGRSAGSNSSVQLATFTAKLSSLSQGYRYLPLYDGGGDQYLFSTLFCKITKEDPVSV
QRLDAEELRAERMGILRQIGQTVFKRTSSTERERGNDMATSAEDKDSSPDLTPTVSAAST
SSLPP
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgccgctacctcgtcggcttcgaccgtcaatggcgatgcccgctctagctta
aagctcactgcttcatcctccaaccccccaaagctacatcatgtcatcacatctatccct
cctgcccccaatccttcatcagcaccatcgtatacctcttctctaactaccactcccaat
tctttacgccccgcctattttccttcaaatgcttcaagcccctcaggcacgcctttacag
attgctaccgacggtctccgaggacgtatacctcccttccctgctatcccttctaccacg
ttcgagctcggggagtccgtgatggccgtcccaggaaatgctcctgcctctggatcgggg
gatgcagtcatctcgaattccaaaggtccgggcttgatgcgcagaatttcccgtggcgcc
gcaaacaagcttactcgaagacgtcaatctgcttcccacaatgaaaagcgcgaccgcagc
tccggccccgtgactatgcggagacgcagtgacagcaagaccggatctcagaacggccgc
gacaacgcactcgaatctagtaacgaggaagacagcaacgatgctcttgactccctcggt
gtttggtgcggatcagagtcatccagtttaccaaatgaaagtttcatggcagcctcccgc
cacaccggcacaatcgcgccaaagattgattcggcgattcagcgtgggactgtcttgacg
aaagttacaaagaagcgcagaaagcaagtccgtttcttcctagacctagatgcgggcaag
gtctactgggatgtctcaaatccggctaaacgcttttacattgacgatatcaaggaaatt
cgggttggcgtggacgcacggaattaccgcgaggagcaccagattccacaagacaccgaa
aatcgctggttcacaattgttatcgccgatgacgagcggtccaaaggtcgcactgtcaaa
acgctgcaccttattgccccaaatactcctatcctggagctttggaccacgactctagaa
catatctcccgatacaggataggtcttatggctggcctggctggttccggtcagagtgag
gcagtcctgaaggcgcattggcagcgtgagatgtcgagattgttccctcatggaaccagg
tcggctgagcaggggagtcttgattttggagccgtggagagcatttgtcgcagtctacat
atcaattgctccaagaacatgcttcgcgctcaattttccaaagctgattctgatgtcaac
ggcaagttgaacttctcacaatttcagaattttgttgctcgcttgaaagagcggaaagac
gtaaaggagatcttcaaggatagcgccacggatgccaaagctggcctgagcgttgatgaa
ttcttgaaattcctgcgaaacatccagaatgagaacgttgactctgatcgaagttattgg
gtctcggttttcgacaagtgtgtacgcaagtctaaatcgcgggtcccaagcatcccggag
tttgaggaggagcaagtccctcgaatggatcttgatgcattttcctctttccttgcgtct
ccatggaacgggttatacgcctcacgtgctccccaatcgcgattcgaccgtcccttgaac
gaatacttcatctcgagttcccacaatacctatcttttaggccgccaggtcgcgggagcg
tccagcacagaggcatacataagtgctttgcaaaaaggatgccgttgtgtagagatcgac
tgttgggatggggctgatggccgaccaattgtgtcccatggaagaactatgaccacgagc
gttctgtttgccgactgtatcaccgtcatcaatcgctatgcattcataactacagatttt
cctctcattttgtctctcgaggtacattgtaacccggagcagcaactggcaatggtcaaa
atcatgaaggataccttcaaagatcagctcgtcctggagccgctattaacaaatagtttt
gtccttccctcgcccgaagagctgaagggacgcattcttgtcaaggtaaagacctgtgac
gagctccaagagggtgtacgacaggaacccgtcggcacattcgccgttcacggccgtaaa
cgcagcgcaagctctcccttcatacggccgacggcatctgaaagctcagcaatcaccagt
ctgcctcctctgtctagccctccgacgcttggactggaaaccgttggctcatttttgacc
caagatagacgctcgttcacaaccaccagtattagcagtgccgcggaggaaagtgatggc
gcattggcgacaatcaggaaagaaaagaaaaggcgccagaagagcaagatcactaaaccc
ctgtctgatctaggtgtctacacccgagggtacaagtggcacagcttctcgtccgctgaa
agtcaacggtataatcatgtctactccttcgccgaacgatcattcgagggtatctgccgt
gacgctgaaaacaaggctcttttcgaaaagcacaaccgaaaatatctgactcgggtctat
ccatccggcttccgcttgagatcttcgaacttcgatccccttaaattttggcgtcgcggt
gttcagatggcggccttgaactggcaaacatacgacataggcatgcagatgaaccaggcc
atgtttgctgctgggagcgatcgaactggttacgtgcttaaacccgagtctcttcgcgcc
ttgtgcccagccgacgaagagaaaacgaaggctacagagtggaagcttgttcgattctca
gtggacgttatctctgcccaacaacttcctcgccctcgcagcattggccccgatgataac
atcaacccttacgtggagattgaaatgtttagtgctgacgatcgtggtcagagcttcgtt
tatggtgagggtggtatgaacgcatccgcccgtaatggcatgtcgggcattggatttccg
caccgtcggcgcacgaagatcgagcagagcaatggatatagcccaatctttaatgatcgc
tttaggttgtcgttggagactaaatatcctgatttggtattcgttcgctggactatctgg
agctcacaggatgggcgcagtgcaggaagtaatagcagtgtccaacttgccacgttcact
gcaaagcttagcagcttatcccaaggataccgctacttgcccctgtatgacggcggcgga
gaccaatatctgttctcaaccttattctgcaagatcaccaaagaagacccagtgtctgtt
cagcggcttgacgcagaagaactgcgagctgagcggatgggtattcttcgacaaattggc
cagactgtctttaagcgcacgtcgtctacggagcgcgagaggggtaatgacatggcaacg
agcgcagaggataaggacagctctccagatctgacaccaacggtttctgcagcgtccact
tcatcgttgcctccttaa

DBGET integrated database retrieval system