KEGG   Aspergillus oryzae: AOR_1_98044Help
Entry
AOR_1_98044       CDS       T01018                                 

Gene name
AO090206000056
Definition
TFIIH and nucleotide excision repair factor 3 complexes subunit
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
aor  Aspergillus oryzae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AOR_1_98044 (AO090206000056)
  Replication and repair
   03420 Nucleotide excision repair
    AOR_1_98044 (AO090206000056)
Transcription machinery [BR:aor03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AOR_1_98044 (AO090206000056)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 480 aa AA seqDB search
MAMAVAPSRPFDYLESLPGTTFYKLYQQPSTALAIFRRMLPDLAKCFVMALLYLKDPLPA
TDLEAWVKAESLKERDNALSILGRLHILSNTVITDNVRAYKVTDPFASSLRQALTGAEKT
QSFGVLWHISDGAAVSIAELDEYARRQWEGVLGYMVGTSGLGIQRDANLSKGVKQLLQAG
HLVEIRDRRVEITQDGFAFVLQDVSTQVWHILMLYVESADAIGMSSVEVLSFVFLLSSLE
LGKAYDKKHLTSNQLRTLTDLADFGIVYQDSPDASHFYPTRLATTLTSDSSALSNPISGS
LSGPSGTGSNKAGSGFIIVETNYRLYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQS
VRRAIEMGITADQIISYLATHAHPQMRKHNVSRSTSNQAGIPPSVLPPTVTDQIRLWQLE
RDRVKATPGFLFKDFVSLAEYEAPCRYAEEIGVLVWKSDRKRMFFVTRHEQVAAFLRSRK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggccatggctgtcgctccctcccgtccatttgattatctggaaagcctgcctggaacg
actttctacaagctctaccagcagccatctaccgccctcgccatcttcaggcgcatgtta
cctgacctagcaaaatgtttcgtcatggcgcttctatatcttaaagaccctctcccagca
acagatctggaggcctgggtcaaggcagaaagcttgaaggagcgagataatgcattgtca
atactgggtcgactccatattctatccaacaccgtgatcacagataacgttcgtgcgtac
aaagtcaccgatccgtttgcctcatcgctccgtcaggctctgacgggcgctgaaaagacg
cagtcctttggtgtactctggcatatatcagatggagcagccgtttccatagctgaactg
gacgagtacgcccggcgtcagtgggagggggtattgggatacatggtcggaaccagcgga
cttggtattcagcgcgatgcaaacctgagcaaaggcgtgaagcaacttttgcaggctggg
catcttgtcgaaatccgggatcgtcgcgtggagatcacacaagatggattcgcttttgtt
ctacaggatgtcagcacccaagtttggcacatccttatgctctatgttgaaagcgcggac
gcaatcggaatgagcagtgtggaggtcctctcgttcgttttcttgctgagcagcttggag
cttggaaaagcatacgataagaagcacctgacatcaaaccaactccgtactctgacggac
ctggcggattttggcattgtctaccaagattccccggatgccagtcatttctaccccact
cgcctcgccactactcttacctccgactccagcgctttgagcaaccccatttcaggttcc
ctctccggtccctctggcacaggctcaaacaaggcgggatctggattcatcatcgtcgaa
acaaactaccgactgtatgcatatacctcttcgccgttgcagatctctcttattgcactt
ttcactacacttaaataccgctttcccaacctgatcaccggcaaaattacccgccagtcg
gtgcgccgcgccatagagatgggtatcactgccgaccaaattatctcgtatctggctacc
cacgctcaccctcagatgcgcaaacataatgtctcccgatctacgtctaatcaggccgga
ataccgccatccgttctgcccccgactgtcactgatcagattcggctttggcaactggaa
cgagatcgcgtcaaagcaacccctggctttttgttcaaggacttcgttagcttggcagaa
tatgaggctccatgtcggtacgctgaagagatcggggttctcgtctggaaatcagatcga
aagcggatgttctttgtaacgaggcatgagcaagttgcagctttcttgaggagtaggaaa
tag

DBGET integrated database retrieval system