KEGG   Aspergillus oryzae: AOR_1_984054Help
Entry
AOR_1_984054      CDS       T01018                                 

Gene name
AO090011000579
Definition
disulfide isomerase
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
aor  Aspergillus oryzae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aor04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 729 aa AA seqDB search
MRASLLACSLLSLFSIPTLASPSDKVLESRDGRLVKRADDPVDPGTLSTTFNGVEVPPMK
DLTPDNFEETIKDGYWFIKQFSPACPHCQKIAPTWQTLYEYYYTSDPLASSSSKPSDTKS
LNSFHGFYNFHFASLNCQAYGDFCKKLDVKYFPQFSLYHNGEKVEEFTGKKSMEGLSEYV
EDKLESIKPGSRPAKGVNLPKPGAKGVDTKAEPEVPAAKDKDPEAGAKAGEKHNEQVSAE
DASSEKASTLKSKTKPKGGPANPQGISVPLTAESFQKLVTTTQDPWFIKFYAPWCHHCQA
LAPNWAQMAREMQNVLNIGEVNCDAEPRLCKDAHVSAFPTMYFFRGGERVEYNGLRGLGD
LVNYAKKAVDVGLGVQDVDATSFKELEEKEEVIFLYFYDHATTSEDFEALERLTLSLIGH
GRIVKTNSAALAERFKISTWPRLLVVRDGRANYYTPIAPKDMRDFRQILGWMRTVWLPIV
PELTASNAREIMDGRYVVLGILSRGRSDEFLQSKRELKSAALEWMDKQVQLFQLERAELR
DAKQLRIEEADDRNDQRALRAAKNMRITIREDDKKQVGFAWVDGDFWERWLRNTYGIDVA
NGERVIINDHDNRRYWDSSSSGSPILASRTSILETIPLVIANSPKLTPKSTVGTFESVFF
SARSFIVNHPILFVLILIFSVVGATWLARARGRRAGRGGILGVTNGNNGFFHLDGKEGLL
NGGSTGKVD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagggcatccttgctggcgtgttcgcttctctctttattctctatccccaccctcgct
tccccttccgacaaggtccttgaatccagagatggtcgacttgtgaagagagccgacgat
cccgtcgacccgggtaccctgtctactaccttcaacggcgttgaagtgcctcctatgaaa
gacttgacacctgataacttcgaggaaaccatcaaggacggctactggtttattaagcaa
ttctctcctgcctgcccgcattgccaaaagatcgctcctacctggcagacgctctatgaa
tattactatacttcggatcctttggcctcttcctcttcgaaaccatccgatactaagtct
ctcaactccttccatggcttctacaatttccatttcgcatcgctgaactgccaggcctat
ggcgacttttgcaagaaattggatgtcaagtacttcccgcaattctcgctgtatcacaat
ggtgaaaaagtagaggagttcacgggaaagaaatcaatggaggggctgagcgagtacgtt
gaagacaaacttgaatcgatcaagcctgggtctcgtcctgcgaagggggtcaacttaccg
aagcccggcgccaagggcgtggatacgaaggctgaaccagaggtccctgctgctaaagac
aaggaccccgaggcaggcgccaaggctggtgaaaagcacaatgagcaggtttccgccgag
gatgcatcttccgagaaagcctccacgttgaagagcaaaacgaaaccgaaagggggtcca
gcaaaccctcaaggaatctctgttcccctcaccgccgagagcttccagaaacttgttacg
accacacaggatccctggttcattaagttttatgccccatggtgtcatcattgccaggca
cttgcccctaactgggcgcaaatggccagggaaatgcaaaacgttctcaacatcggagaa
gtaaactgcgacgctgagcccagactttgcaaagatgcccatgtatcggcctttcccact
atgtatttcttccgcggtggtgagagggtcgaatacaacggtcttcggggtctaggcgat
ctagtcaactatgccaaaaaggcagttgacgttggcttgggtgttcaggacgtcgacgcc
acttccttcaaggagctggaggagaaggaagaagtcattttcttgtacttctacgaccac
gctacgacatcggaggattttgaggctctggagcgcctaactcttagcttaatcggccat
ggacgaattgtgaaaacgaacagcgcagccttggctgaacggttcaagatttcaacatgg
ccccgccttcttgttgtccgagacggtcgagccaactactatactccgattgctcccaag
gatatgcgagacttccgacagatcttgggatggatgcgcactgtgtggctacccatagtc
cccgagcttacagcctccaatgctcgggaaatcatggatggcaggtatgtggttctcgga
atcttaagccggggacgctcggacgaattcttgcagtcaaagagggagctgaagagcgcg
gctcttgaatggatggacaagcaggttcagttgttccaattggaacgggcagaacttcga
gatgccaaacagctccgcattgaggaggctgatgaccgtaacgaccagcgcgcattgcga
gctgccaaaaacatgcgcatcactatacgtgaagatgacaagaaacaagtcggcttcgcg
tgggttgacggcgatttctgggaacggtggttgagaaatacgtatggtattgatgtggca
aatggggaacgagtcatcatcaacgatcacgataaccgacggtactgggactcatcttcg
agcgggtctcctatcctggcctcgcgtacttctattctcgaaactattcctcttgtgatc
gccaactcccctaagttgacaccgaagtccactgttggcacctttgagtctgtctttttc
tccgctcggtccttcatcgtcaaccaccccatactctttgtcctcatcctgatcttctcg
gttgttggcgcgacgtggttggcacgagccagaggccggcgtgccggccgcggtggcatt
cttggtgtcactaacggcaacaatggtttctttcaccttgatgggaaagaaggtctgttg
aacggcggctcaactggaaaggttgattag

DBGET integrated database retrieval system