KEGG   Aspergillus oryzae: AOR_1_984054Help
Entry
AOR_1_984054      CDS       T01018                                 

Gene name
AO090011000579
Definition
disulfide isomerase
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
aor  Aspergillus oryzae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aor00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AOR_1_984054 (AO090011000579)
Enzymes [BR:aor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AOR_1_984054 (AO090011000579)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 729 aa AA seqDB search
MRASLLACSLLSLFSIPTLASPSDKVLESRDGRLVKRADDPVDPGTLSTTFNGVEVPPMK
DLTPDNFEETIKDGYWFIKQFSPACPHCQKIAPTWQTLYEYYYTSDPLASSSSKPSDTKS
LNSFHGFYNFHFASLNCQAYGDFCKKLDVKYFPQFSLYHNGEKVEEFTGKKSMEGLSEYV
EDKLESIKPGSRPAKGVNLPKPGAKGVDTKAEPEVPAAKDKDPEAGAKAGEKHNEQVSAE
DASSEKASTLKSKTKPKGGPANPQGISVPLTAESFQKLVTTTQDPWFIKFYAPWCHHCQA
LAPNWAQMAREMQNVLNIGEVNCDAEPRLCKDAHVSAFPTMYFFRGGERVEYNGLRGLGD
LVNYAKKAVDVGLGVQDVDATSFKELEEKEEVIFLYFYDHATTSEDFEALERLTLSLIGH
GRIVKTNSAALAERFKISTWPRLLVVRDGRANYYTPIAPKDMRDFRQILGWMRTVWLPIV
PELTASNAREIMDGRYVVLGILSRGRSDEFLQSKRELKSAALEWMDKQVQLFQLERAELR
DAKQLRIEEADDRNDQRALRAAKNMRITIREDDKKQVGFAWVDGDFWERWLRNTYGIDVA
NGERVIINDHDNRRYWDSSSSGSPILASRTSILETIPLVIANSPKLTPKSTVGTFESVFF
SARSFIVNHPILFVLILIFSVVGATWLARARGRRAGRGGILGVTNGNNGFFHLDGKEGLL
NGGSTGKVD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagggcatccttgctggcgtgttcgcttctctctttattctctatccccaccctcgct
tccccttccgacaaggtccttgaatccagagatggtcgacttgtgaagagagccgacgat
cccgtcgacccgggtaccctgtctactaccttcaacggcgttgaagtgcctcctatgaaa
gacttgacacctgataacttcgaggaaaccatcaaggacggctactggtttattaagcaa
ttctctcctgcctgcccgcattgccaaaagatcgctcctacctggcagacgctctatgaa
tattactatacttcggatcctttggcctcttcctcttcgaaaccatccgatactaagtct
ctcaactccttccatggcttctacaatttccatttcgcatcgctgaactgccaggcctat
ggcgacttttgcaagaaattggatgtcaagtacttcccgcaattctcgctgtatcacaat
ggtgaaaaagtagaggagttcacgggaaagaaatcaatggaggggctgagcgagtacgtt
gaagacaaacttgaatcgatcaagcctgggtctcgtcctgcgaagggggtcaacttaccg
aagcccggcgccaagggcgtggatacgaaggctgaaccagaggtccctgctgctaaagac
aaggaccccgaggcaggcgccaaggctggtgaaaagcacaatgagcaggtttccgccgag
gatgcatcttccgagaaagcctccacgttgaagagcaaaacgaaaccgaaagggggtcca
gcaaaccctcaaggaatctctgttcccctcaccgccgagagcttccagaaacttgttacg
accacacaggatccctggttcattaagttttatgccccatggtgtcatcattgccaggca
cttgcccctaactgggcgcaaatggccagggaaatgcaaaacgttctcaacatcggagaa
gtaaactgcgacgctgagcccagactttgcaaagatgcccatgtatcggcctttcccact
atgtatttcttccgcggtggtgagagggtcgaatacaacggtcttcggggtctaggcgat
ctagtcaactatgccaaaaaggcagttgacgttggcttgggtgttcaggacgtcgacgcc
acttccttcaaggagctggaggagaaggaagaagtcattttcttgtacttctacgaccac
gctacgacatcggaggattttgaggctctggagcgcctaactcttagcttaatcggccat
ggacgaattgtgaaaacgaacagcgcagccttggctgaacggttcaagatttcaacatgg
ccccgccttcttgttgtccgagacggtcgagccaactactatactccgattgctcccaag
gatatgcgagacttccgacagatcttgggatggatgcgcactgtgtggctacccatagtc
cccgagcttacagcctccaatgctcgggaaatcatggatggcaggtatgtggttctcgga
atcttaagccggggacgctcggacgaattcttgcagtcaaagagggagctgaagagcgcg
gctcttgaatggatggacaagcaggttcagttgttccaattggaacgggcagaacttcga
gatgccaaacagctccgcattgaggaggctgatgaccgtaacgaccagcgcgcattgcga
gctgccaaaaacatgcgcatcactatacgtgaagatgacaagaaacaagtcggcttcgcg
tgggttgacggcgatttctgggaacggtggttgagaaatacgtatggtattgatgtggca
aatggggaacgagtcatcatcaacgatcacgataaccgacggtactgggactcatcttcg
agcgggtctcctatcctggcctcgcgtacttctattctcgaaactattcctcttgtgatc
gccaactcccctaagttgacaccgaagtccactgttggcacctttgagtctgtctttttc
tccgctcggtccttcatcgtcaaccaccccatactctttgtcctcatcctgatcttctcg
gttgttggcgcgacgtggttggcacgagccagaggccggcgtgccggccgcggtggcatt
cttggtgtcactaacggcaacaatggtttctttcaccttgatgggaaagaaggtctgttg
aacggcggctcaactggaaaggttgattag

DBGET integrated database retrieval system