KEGG   Aspergillus oryzae: AOR_1_984134Help
Entry
AOR_1_984134      CDS       T01018                                 

Gene name
AO090102000592
Definition
alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aor  Aspergillus oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AOR_1_984134 (AO090102000592)
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AOR_1_984134 (AO090102000592)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 664 aa AA seqDB search
MVSLPRVAAATSSVILRLAAFIFLRWIPGHHFPPLIFTSLVVYLSSLFSLSRPADESTTN
RPHDLKRSRNTSRSAESLSNDSVLKTLLTGLPSPTSPLVTRLTVLVNIVLTLFTSDLLLR
GLVFYPANDVAFSRIGYVSPTTANLLVREPDSAQLPLVVFYQEAEQDDPLKWVEEGIIYA
LDESTDFTTSVTLQNLKPSSHYRYSLSNNRTGSFVTAPLPGSASADRLSFLTSSCIKPNF
PYNPLSHPLRIEGIEKMTETVSKLPSLLRPAFMLFLGDFIYIDVPQRFGSSVSHYRSEYR
RVYSSPSWYSHGDNPAIDLPWIHTLDDHEIENDWSKGNNTAPYLAAADPYIHYHVSVNPP
IPATPFAKPENTTYFSFINGPASFFMLDTRTYRSEPAQPDSTILGSAQLQSLLAYLSRPE
PAEVRWKIVASSVPFTKNWRVGTTDTWGGFLNERRTVFEAMWRAERELGIRIILLSGDRH
EFGATRFPDPTFDYTPDELLPDTAGEGLHEFSVGPLSMFYLPIRTYHQTDNEDVTVKYIP
TGNTKYGLIDIDIRDETVLISGRTATVPSSVLTYSLYVDNDVAWKYSLSVPLPGYEDVAS
AASVRHPRLLPGKVLEDNRELVGWSAQLRAVLSQVEEVRGQLVNQFRAQVSKLLDRTGTA
ERLD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggtttccttgccgcgggttgccgcggccacgagctccgtgatactcagactcgccgcc
ttcatctttcttcgctggatccccggtcatcatttcccacctctaatcttcacctcgtta
gtggtgtatctatcttcattgttctcgctcagtcggccggctgatgagagcaccaccaat
cgcccccatgacttgaaacgctccaggaacacttccagatctgcagagtctctatctaat
gatagcgttcttaagacgcttttaacgggactgccctcccccacgtcgccgttggtgacc
cggctgacagtgctggttaacattgtccttacactcttcacttccgaccttctactgcgt
gggttagttttctatcctgcaaacgatgttgccttctcgcgcattggctatgtctcccca
actacagcgaatttgctcgttcgagagccggactcggctcaactacccctggtggtcttc
taccaagaagcggaacaggatgaccccttgaaatgggtggaagaaggcattatatatgca
cttgatgaatcgacggatttcacaacctcggtgactttgcaaaacttgaaaccatcctcg
cattatcgatactctttgtccaacaatcgcacaggctcttttgtcaccgcgcctcttcct
ggttcggcatctgccgaccggcttagctttttgacgtctagctgcataaagccaaacttc
ccgtacaatccgttatctcatccattgcgtatcgagggcattgagaagatgactgagacc
gtcagcaaattgccatccttgcttcgaccggcttttatgctgttcctcggtgacttcatc
tatatcgacgttccccagcgctttggctcgtctgtatcacattaccgcagtgaatatcgt
cgtgtgtattcttctccctcgtggtattcccatggtgataacccggccatcgacctgccg
tggatacacactctagacgaccatgagattgagaatgactggtcgaagggcaacaataca
gctccctatttggctgctgctgacccctatatccattaccacgtcagtgtgaaccccccg
atcccagccactccttttgccaagccagaaaacacaacctatttctctttcatcaacggc
ccggcgtcattcttcatgttggatacccgcacctatcgctccgagcccgcccaaccggac
tctaccattcttggctcagcgcaactgcagtccttgcttgcatatctgtctcgtcctgaa
ccagccgaagtgcgttggaagatcgtcgcctccagcgttccatttactaaaaactggcgc
gtcggcacgaccgacacatggggtgggtttttgaacgagcgtcgcacagtgtttgaagcc
atgtggcgcgctgagcgagagctgggaattcgtatcatcctgctcagtggagacagacac
gagttcggggcgacccgattccctgatcctacatttgactacacgcccgatgaacttctc
cccgataccgccggagaaggcctgcacgaattcagtgtcggtccgctcagtatgttctac
ctgcccatccggacctaccatcaaaccgacaatgaagatgtcacggtcaaatacatccca
accggtaacaccaagtacggattaatcgatatcgacatccgcgatgagaccgtactcatc
agtggcaggacggcaaccgtacccagttccgtccttacctactcactctatgttgacaac
gatgtcgcctggaaatatagtctcagcgtcccacttcccgggtatgaggatgttgcctcg
gctgcctctgtcagacacccgcgactcctgccaggtaaagtccttgaggacaaccgtgaa
ctagttggatggagtgcccagctcagagccgtccttagtcaggtggaggaagtaagagga
cagctagttaaccagtttagggctcaagtctctaaacttttggatagaacgggaacagca
gaaagactcgactga

DBGET integrated database retrieval system