KEGG   Aspergillus oryzae: AOR_1_988014Help
Entry
AOR_1_988014      CDS       T01018                                 

Gene name
AO090026000543
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aor  Aspergillus oryzae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOR_1_988014 (AO090026000543)
   01230 Biosynthesis of amino acids
    AOR_1_988014 (AO090026000543)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOR_1_988014 (AO090026000543)
   00051 Fructose and mannose metabolism
    AOR_1_988014 (AO090026000543)
   00562 Inositol phosphate metabolism
    AOR_1_988014 (AO090026000543)
Enzymes [BR:aor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AOR_1_988014 (AO090026000543)
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AOR_1_988014 (AO090026000543)
  Exosomal proteins of bladder cancer cells
   AOR_1_988014 (AO090026000543)
  Exosomal proteins of melanoma cells
   AOR_1_988014 (AO090026000543)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MASAEQTYPVLPSTLLIISLKMYFTPTRTLDYLRALLDPKNDIVRPENRSKLLLALIPDF
LTIYPSNEIIKNYESSLAPQEAKALPPPFLLGAQDCFWEPLGAYTGEVSPLALRSMGVSI
VELGHAERRSIFGETDDQTGRKAAAASAHGMVPLVCIGEVTAPGPVASQAVGLAVRECEV
QVRAVLKAIPAHAPVIFAYEPVWAIGKPKPAGVDHISAVVDGIKAVIGERPGDVRILYGG
SAGPGLWGAGGLGKAVDGMFLGRFAHEIEGVRKVIREVEETLNVA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcggagcagacatacccggtgctccccagcaccttactcatcatctccctg
aagatgtacttcacacccacccgaacattagattatctccgcgccctcctcgaccccaaa
aatgacattgtgcggccagagaaccgctccaagctcctgttggccctgatccccgacttc
ctgaccatctaccccagcaacgaaatcatcaaaaactatgaatccagcctagcccctcag
gaagccaaggccctgccgcccccgttcctcctcggcgcccaggactgcttctgggagccg
ctgggcgcatacaccggggaagtatccccactcgctctccgctccatgggcgtgtccatc
gtcgaactgggccacgccgagcgccgctccatcttcggcgaaacagacgaccagacaggt
cgcaaggccgctgcggcctccgcgcacggtatggtgccgctcgtatgcattggcgaggtc
acagcgcctggccccgttgcgtcccaggccgtcggactcgccgtgcgcgagtgcgaggtg
caagtccgcgcagtcctaaaagccatccccgcccatgcccctgtgatcttcgcctatgag
cccgtgtgggcgatcgggaaacccaagcccgctggagtcgatcacatttctgccgtggtg
gacggcatcaaggcggtgattggggagcgtcctggggacgtccgtattttgtatggggga
agtgccgggccgggcctgtggggcgcgggcggtctggggaaagccgttgacggcatgttc
ctggggagattcgcccatgagatcgagggtgtgcggaaggtgatcagggaagtcgaggag
acgttgaacgttgcttga

DBGET integrated database retrieval system