KEGG   Aspergillus oryzae: AOR_1_994054Help
Entry
AOR_1_994054      CDS       T01018                                 

Gene name
AO090011000588
Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aor  Aspergillus oryzae
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AOR_1_994054 (AO090011000588)
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AOR_1_994054 (AO090011000588)
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AOR_1_994054 (AO090011000588)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDS
IKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHS
FIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILS
TDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQIL
ARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKS
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagtaaaagcagcccgctacggcaaggacaatgtccgcgtctacaaggttcac
aaggacgagaagaccggtgtccagacggtgtacgagatgaccgtctgtgtgcttctggag
ggtgagattgagacctcttacaccaaggccgacaacagcgtcattgtcgcaaccgactcc
attaagaacaccatttacatcaccgccaagcagaaccccgttactcctcccgagctgttc
ggctccatcctgggcacacacttcattgagaagtacaaccacatccatgccgctcacgtc
aacattgtctgccaccgctggacccggatggacattgacggcaagccacaccctcactcc
ttcatccgcgacagcgaggagaagcggaatgtgcaggtggacgtggtcgagggcaagggc
atcgatatcaagtcgtctctgtccggcctgaccgtgctgaagagcaccaactcgcagttc
tggggcttcctgcgtgacgagtacaccacacttaaggagacctgggaccgtatcctgagc
accgacgtcgatgccacttggcagtggaagaatttcagtggactccaggaggtccgctcg
cacgtgcctaagttcgatgctacctgggccactgctcgcgaggtcactctgaagactttt
gctgaagataacagtgccagcgtgcaggccactatgtacaagatggcagagcaaatcctg
gcgcgccagcagctgatcgagactgtcgagtactcgttgcctaacaagcactatttcgaa
atcgacctgagctggcacaagggcctccaaaacaccggcaagaacgccgaggtcttcgct
cctcagtcggaccccaacggtctgatcaagtgtaccgtcggccggtcctctctgaagtct
aaattgtaa

DBGET integrated database retrieval system