KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0013Help
Entry
APP7_0013         CDS       T00717                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    APP7_0013
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APP7_0013
Enzymes [BR:apa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     APP7_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13689..15191
Genome map
AA seq 500 aa AA seqDB search
MKRLLPFLTELDAWVTELKPLKQMTLDSRQVDEGDLFVALKGHQVDGRRFIQKAIEQGAA
LVLAEADEGQDEIELDAKFAKYNLDRTACKVVLVPNLARILSEIAGAFYANPSEKLTLVG
VTGTNGKTTSAQLLAQWHNLLGGKSAVMGTIGNGLYGKVQEAANTTGSAIEVQRNLADFV
EMGADFCAMEVSSHGLAQYRAEALSYDLAVFTNLSRDHLDYHKTMEEYAQAKFRLFSELD
TKAQVLNADDEVGREWLAKLPDAVAVSTDASFSSEHKFVKATDVSFSLQGVKIAFESSWG
NGELNSRLIGAFNVNNLLTALAGLLVLGHDLPKLIETAPLLQGVAGRMECVVSQKNPQNR
PLVLVDYAHTPDALEKALQAARLHTEGELYCIFGCGGDRDAGKRPMMAAIAEELADKVIA
TDDNPRTEDNAKIMADILNGFVQVEKVQVIHDREQAIKTAIEQANEKDVILIAGKGHEDY
QIIGTTKHHFSDQETAAKYL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttacttccctttctcaccgaacttgatgcttgggtgacggaattaaaaccg
cttaagcaaatgacgttggattctcgccaagttgatgaaggcgatctgtttgtggcgtta
aaagggcatcaagtggatggtcgccgatttattcaaaaagcgattgagcaaggcgcagct
ttagtcttggcggaagcggacgaagggcaggacgaaattgagttggatgcgaaatttgca
aaatataacttagatcgcaccgcttgtaaggtggttttagtaccgaatttggctcgtatt
ttatcggaaattgccggtgcgttttatgccaatccgtctgaaaaactcactctcgtaggt
gtaaccggtaccaacggcaagaccacaagcgcgcaattacttgcccaatggcataaccta
ttaggcggaaaatcggcggtaatggggacgatcggtaacggtttatacggcaaagtacaa
gaagcggcaaataccaccggttcggcgattgaagtgcaacgtaatttagccgactttgtg
gaaatgggcgctgatttttgtgcgatggaagtttcttcgcacggcttagctcaatatcgt
gcggaagcgttaagctatgatttagcggtattcactaatttaagccgtgatcatctcgat
taccacaagacaatggaagaatatgcacaagcaaaattccgtttgtttagcgaattagat
accaaagcacaagtattaaacgctgatgatgaagtcgggcgtgaatggttggcaaaattg
ccggatgcggttgccgtcagtaccgatgcgagctttagtagcgagcataaattcgttaaa
gcgaccgatgtgagctttagcttacaaggtgtaaaaattgcgtttgaatcgagctggggc
aacggcgagttaaatagccgtttaatcggtgcatttaacgtcaataatttactcacagca
ttagccggcttattagtgcttggtcatgatttaccaaaattaattgaaactgcaccgctt
ctgcaaggggttgccgggcgtatggagtgtgtcgtttcgcaaaaaaatccgcaaaataga
ccgcttgtattagtcgattacgctcatacgccggatgcgttggaaaaagccttgcaagcg
gcacgattacataccgaaggcgagctttattgtattttcggttgcggtggtgatcgtgat
gcgggcaaacgcccgatgatggcggcgattgccgaagaactggcggataaagtgattgcg
accgatgacaatccgagaaccgaagataacgctaagattatggcggatattctcaacggt
ttcgttcaagtggagaaagtacaagtgatccacgatcgtgaacaagcaattaaaaccgca
attgaacaagcgaatgaaaaagatgtgattttaattgccggtaaagggcacgaagattac
caaattatcgggacgactaagcatcatttttcggatcaggaaaccgcggctaaatacctg
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system