KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0179Help
Entry
APP7_0179         CDS       T00717                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APP7_0179
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     APP7_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203026..203538
Genome map
AA seq 170 aa AA seqDB search
MPFLLASLTETDMMMKTVYIALGSNLDNPLAQVKQAVESLKTFAINFEISPFYGSKPVGP
QDQPDYVNAVAKFDTDLTALELLDKLQSIENAQGRVRIRRWGERTLDLDIILYGDERIHN
ERLIVPHIEMQNREFVIVPMYDLNPDLVLPSGQKLAEIYQRFKHHQMVIF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgccttttcttttagcaagtttgacagaaacggatatgatgatgaaaacggtttatatt
gctttaggttccaatttggataacccgcttgcgcaagttaaacaagcggtcgaatcttta
aaaacatttgcaattaattttgaaattagcccgttctacggtagtaagccggtcgggccg
caagatcagccggattatgtgaatgcggtggcaaaattcgataccgatttaacggcgctg
gaattgctggataaattacaaagcattgaaaacgcccaaggaagagtgcgaattcgccgt
tggggcgaacgtacgctggatttggatattatcttatacggcgatgaacggattcacaac
gaacgtttaatcgtaccgcatattgaaatgcaaaatcgtgagtttgtgattgtgcctatg
tatgatcttaaccccgatttagtgctgccaagcggtcaaaaattagcggaaatttaccaa
cgctttaaacatcatcaaatggtcatattctaa

DBGET integrated database retrieval system