KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0255Help
Entry
APP7_0255         CDS       T00717                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APP7_0255
Enzymes [BR:apa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     APP7_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283853..285790
Genome map
AA seq 645 aa AA seqDB search
MLTLLYELKETNVISELDYQFAKMIDRKQQSYPYTEQQKNLAVLLAALVSFHVMQGHAAI
RLDSQASRFFFGLSNRNEEKALNDEILQKIGGITPLEWQGVLQNHIAFSSDPIQVAPMLF
QHGLLYFYRYWQAENNIANYLVKAVEFPEQIANTALNKQILEKLFEKSDEINWQKIAVAT
AIKQKFSIISGGPGTGKTTTVAKLLAALQEKQLRSGKAMLNVALVAPTGKAAARLKESIT
LSLSVLNLNFEIPTTASTIHRLLGIRPQSDEPRYHSKNPLHIDLLVVDEASMIDLFLMEK
LMAALKPNTRLIILGDKDQLASVEAGAIMGELGAFLQQGYSRKHCDYLNQVTEYQLVPKG
KSLPICDSLCHLKKSYRFDANSGIGQLAKLVNEKQAVESWQLFAKGSADLSLIEYAHTSD
FPEKQQWIQNCVKQITDKAVELYKEYLTLVKQRYNNPTKVSVNEIFEVFQKVRFLSALRI
SELGVEQLNKRIETALATAKLISLEQSKNYYIGKPLLITQNSPQNHIYSGDIGIILPDEN
GISRVYFDTKIDDGYLSLSLNRLPEFEPAYVMTVHKSQGSEFEHTLLITPLHFAPVMSKE
LIYTAITRAKKHFTLFGEKQVWLQAVNNNLQRQSGLKAQLMHLFS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcttttatatgagttaaaagaaacgaatgtgatttccgaattggattatcaa
ttcgctaaaatgattgatcgtaaacagcaaagttatccctataccgaacaacaaaaaaac
ttggcggtattgcttgccgcattagtttcttttcacgtaatgcaaggtcatgcggctatt
cgtttggattctcaagcctcacggttttttttcggtttatcaaatcgaaatgaggaaaag
gcgcttaatgatgaaattttgcaaaaaatcggcggaatcacgccgcttgaatggcagggc
gtattacaaaatcatattgcctttagttcggatcctatacaagttgcaccgatgctgttt
cagcatggactactttatttttatcgttactggcaggcggaaaataatatcgcgaattac
ttagtgaaagcggtcgaatttcccgaacaaattgccaataccgcattgaataagcaaatt
ctagaaaaactatttgaaaagtcggatgaaataaattggcaaaaaatagcggtcgctacg
gctatcaaacaaaagtttagcataatttcaggcgggccgggaaccggtaaaactacaacg
gtcgccaaattattagctgcgttgcaagaaaaacagctacgtagcggtaaagcaatgttg
aatgttgcgcttgttgcaccgacaggaaaagcggcggcacgtttaaaagagtcaatcaca
ttaagtttaagcgtgcttaatttgaattttgaaattccaacgaccgcctcgacaattcat
cgtttgttaggaatacgtccgcaaagtgatgagcctcgttatcactcaaaaaatccgtta
catattgatcttttagtggtggatgaagcgtctatgattgatcttttcttaatggaaaaa
ttaatggcggcattaaaaccgaatacccgattaattattttaggcgataaagatcagctt
gcgtcggttgaagccggagcgattatgggagaactcggagcgtttcttcaacagggatat
agccggaaacattgcgattatttgaatcaagttaccgagtatcaattagttccgaaagga
aaatcattacctatttgtgattcgttatgtcatttgaaaaaaagttatcgttttgacgct
aattccggaatcggtcagttggcgaaactggttaatgaaaagcaagcggttgaatcttgg
caactttttgcaaaaggctcagcggatttatctttgatcgaatatgcacacacttcggat
ttcccggaaaaacagcagtggattcaaaattgcgtgaaacaaataacagataaagcggtc
gagctttataaggaatatctaacgcttgttaaacaacgttacaataatccgacgaaagtg
tcggtaaatgaaattttcgaggtttttcaaaaagtaagattcttatccgcattgcgtata
agtgaattgggcgtagagcaattaaataaaaggatagaaacggcattagcgacggcaaaa
ctgatttctttagaacaaagtaaaaattactatatcggtaaaccgttactcattacacag
aactcgccgcaaaatcatatttatagcggcgatatagggattatcttaccggatgagaac
ggaatatcgagagtttattttgatacgaaaattgacgatggatatttaagtctttctctg
aatagacttcccgaatttgaaccggcttatgtaatgacggttcataagtcgcaaggttct
gaattcgaacataccttactgataacgccattgcactttgcaccggttatgagtaaagaa
ttaatttatacggcgattacccgagctaaaaagcattttactttattcggagaaaaacaa
gtttggttacaggcggtgaataataatcttcagcgtcaaagcggattaaaagcacaatta
atgcacttgttcagttaa

DBGET integrated database retrieval system