KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0258Help
Entry
APP7_0258         CDS       T00717                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    APP7_0258
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     APP7_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
293775..294395
Genome map
AA seq 206 aa AA seqDB search
MLGNLYILSAPSGAGKSSLINALLADLPRSEVQLSVSHTTRNPRPGEEHAVHYYFTHHAE
FESLIEQGHFLEWAEVFGNYYGTSLPMIEKSLENGIDVFLDIDWQGARQIRNKVPNVKTI
FILPPSREELEKRLIGRGQDSAETIGKRMAEAVSEMSHYNEFDYVIVNDDFQTALSELKS
ILTSERLKQASQAVRYEKLIRQLLSK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtaatctttacattctttccgcaccaagcggtgccggtaaatcctcattgatt
aatgcgttattagcggatttacctcgttcggaagttcaactttctgtttcgcatactacg
cgtaatcctcgtccaggagaggaacatgcggtacattattattttactcatcatgcggaa
ttcgaatcgttaatcgagcaagggcattttttagaatgggctgaagtattcggtaattat
tacggtacatctttgccgatgatagaaaagagtttagagaacggcattgatgtcttttta
gatatcgactggcaaggtgcacgtcaaattcgtaataaagttccgaatgtaaagactatt
tttattttaccgccttctcgtgaggaattggaaaaacgtttaatcggaagaggtcaagat
tcggcagaaacaatcggtaaaagaatggccgaggccgtatcggaaatgtctcattataat
gagtttgactatgtgatcgtaaatgatgatttccaaaccgcattaagcgagttgaaaagt
attttaacttccgagcgtttaaaacaagcttctcaagcggttcgatatgaaaaattaatt
cgtcaattactttcgaaataa

DBGET integrated database retrieval system