KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0271Help
Entry
APP7_0271         CDS       T00717                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APP7_0271
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APP7_0271
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APP7_0271
Enzymes [BR:apa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APP7_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
304905..305957
Genome map
AA seq 350 aa AA seqDB search
MKFICNQCQQIAPVSTRQAKCQCGGLWTLDYQPPKFDLNEIDQHEWNLFRYRKFIALQDE
SWRDISLGEGMKPIVRFDENVLLKMDYFMPMLSFKDRGAVVQDSGGNAGNSVAAYCAKAG
IQCEIFVPEGTSPKKINMIEAHGAKANVIKGSRDHCSDVCRAKVENEGVYYANHVYNPFF
YEGTKTYIYETFEQLGRIPKHIVVPVGNGTLFIGVIKGLEHLLESGVIDEMPTIIALQSE
YCDPLLQAVKKGQKFAEQVEIKPTIAEGIAIGQPMRASEILAYAEKYAIRFVHAPEDKIL
AARNALAKKGIYCEHTTAANYAAYLHYCELYGAVEDCLITICGAGLKSDH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatctgtaatcaatgccaacaaattgcgccggtatctactcgccaagcaaaa
tgtcaatgcggaggcttatggacactggattatcaaccgcctaaattcgatctcaacgag
attgatcagcatgagtggaacttatttcgttatcgaaaatttattgctttgcaagatgaa
agttggcgtgatatttccttgggggaggggatgaagccgatagtccgttttgatgaaaat
gtattattaaaaatggattactttatgccaatgctttcctttaaagaccgtggtgcggtg
gtacaagatagtggtggtaatgcaggcaatagtgttgcagcctattgtgctaaagcgggt
attcaatgtgaaatttttgtaccggaaggaacatcgccgaaaaaaattaatatgattgag
gcgcatggtgctaaagctaatgtgattaaaggtagccgtgatcattgttcagatgtatgt
cgtgctaaggttgaaaatgagggcgtttattatgctaatcacgtgtataaccccttcttc
tacgaaggtacgaaaacctatatttatgaaacgtttgaacagctcgggcggattccaaaa
catattgtcgttccggttggaaacggtactttgtttattggtgtcattaaaggactagaa
catttgttggaaagtggcgttattgatgaaatgccaacgattattgcattacaaagcgaa
tattgtgatccattattgcaagcggtcaaaaaagggcaaaaatttgcagaacaggttgag
attaagccgactatcgccgaaggtattgccattgggcagcctatgcgagcaagtgaaatt
ttagcttatgcggaaaaatatgcgattcgttttgttcatgctccggaagataaaattctt
gcggcacgaaacgctttagccaaaaaagggatttattgtgaacacactaccgcagctaac
tatgcggcttatcttcactactgtgagctatatggtgcagtagaagattgcttaattacg
atatgtggtgccggactgaaatcagaccattaa

DBGET integrated database retrieval system