KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0285Help
Entry
APP7_0285         CDS       T00717                                 

Definition
holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APP7_0285
Enzymes [BR:apa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     APP7_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320868..321473
Genome map
AA seq 201 aa AA seqDB search
MIGRLHGKIIEKQPPEMVIDVQGVGYEVLLPMTSFYSLPQIGEEATIFTHLVVREDAHLL
FGFAQKQDRTLFRELIKTNGVGPKLALAILSAMSVSQFANAVEHEELAKLTKIPGIGRKT
AERLLVELKGKFKGVAQSDFFEEHSVETIVATHSHDPADEARDALVALGYKLADAEKMIK
KVNKAGATSEQLIREALKASL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaagattacatggtaaaattattgaaaaacaaccacctgaaatggtaattgat
gttcaaggtgtcggatatgaagtgctattgccgatgacgagcttttacagtttgccgcaa
atcggtgaagaagccacaatctttacgcatttagtcgtacgtgaagatgcgcatttatta
tttggttttgcacaaaagcaagacagaacgttatttcgtgaattaattaaaaccaacggt
gtcgggcctaaattagcccttgcgattttatcggcgatgtcggtttcacaatttgcgaat
gcggtagaacatgaagaattagccaaattaactaaaatcccgggcattgggcgtaagaca
gccgagcgtttattagtagaactcaaaggcaaattcaaaggtgtggcacaaagtgatttc
tttgaagaacattcggttgaaacgattgttgcaacacattcacacgatccggcagatgaa
gcccgtgatgctttagtagcgttaggctataaactcgctgatgctgagaagatgattaag
aaagtgaataaagcgggtgcaaccagcgaacaattaattcgtgaagcattaaaagcctct
ctttaa

DBGET integrated database retrieval system