KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0351Help
Entry
APP7_0351         CDS       T00717                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APP7_0351
Enzymes [BR:apa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     APP7_0351
Exosome [BR:apa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APP7_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
392993..395326
Genome map
AA seq 777 aa AA seqDB search
MKTYTYSKQDLSFIEQLSQAYCKDPFSYLGLHQAGDVSVIRVFLPEATTVKILSADGQIL
SEALKIDDSGLFVAQLSQQYSSLNYRLRVGYSLAEIDLEDPYRFTSSLLPMDNWLLAEGT
HLRPYEILGAHLKTQEGVSGVHFSVWAPNARRVSVVGDFNYWDGRVNPMRFHAESGIWDI
FLPNVEKGALYKFEILDSNGNIRLKSDPYAFASQFRPDTASVVTGLPEKIEVDAKLRHAN
DPDQPISIYEVHLGSWRRHLENNYWLNYEEIANELIPYVKDMGFTHIELLPITEYPFDGS
WGYQPTGLYSPTSRFGSPDDLRTLIRKAHEAGINVILDWVVGHFPTDSHGLTEFDGSHLY
EHQDPREGYHQDWNTLIFNYGRHEVFNYLSSNALYWTERFGIDGLRVDAVSSMIYRDYSR
KDGEWIPNQYGGRENLEALDFLRRTNRMLKKEGHGAVVIAEESTSFAGITHSPTENGVGF
DYKWNMGWMNDTLRYMSLDPIYRQYHHDWMTFGMMYQYSEKFVLPLSHDEVVHGKCSILG
KMSGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNYNESLDWFLLGEQGGGWH
KGVLNWVRDLNRTYQKYPALYQLDYDPAGFEWLVVDDWQQSVFAFERKAKNGESVIVVSN
FTPVVRHNYRIGVRQDGTYTEILNSDAAYYEGSNVGNYGEIECEAIESHGKPFSIELSIP
PLSTIFIACQPKPKEAVEAEQDIVKMAEVAMQKALKPTKKTVSVKAKAHKKAHKNKK
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatatacgtattctaaacaagatttatcttttattgagcaactttctcaagcg
tattgtaaagatcctttctcttatctcggcttacatcaagcgggtgatgtgagcgtaatt
cgtgtttttctgccggaagcaacgacagttaaaattctgagtgcagacggtcaaatactt
tccgaagctttgaaaatagacgactccggcttgtttgtagcgcaattgtctcagcagtat
tcttccttaaattatcgtttaagagtcggttattctttagcggaaatcgaccttgaagat
ccctatcgttttacttcttcgcttctaccgatggataactggttattggcggaaggaact
caccttcgtccatacgaaatcttaggtgcgcatttgaaaacgcaagaaggcgtttccggc
gtacatttttccgtttgggcgccgaatgcccgtcgtgtatcggttgtcggcgatttcaac
tattgggacgggcgagtaaacccgatgcgttttcatgcggaaagcggcatttgggatatt
ttcctacctaatgttgagaaaggtgcattatataaattcgaaattttagatagcaacggt
aacattcgtttgaaatccgacccttatgcgttcgcatcgcaattcagaccggatacggca
tccgtagtaacgggtttaccggaaaaaatagaagtggatgcgaaactacgtcatgcgaat
gatcccgaccagccgatttcaatttatgaagtgcatctcggttcgtggcgtcgtcacctt
gaaaataattattggctgaattatgaagaaattgccaacgaattaattccttatgttaaa
gatatggggttcactcatatcgaattgttaccgattaccgaatatccgttcgacggttct
tggggttatcaaccgaccggactttattctccgaccagccgattcggttctccggacgat
ttacgtaccttgattcgtaaagcgcatgaagcgggtattaatgtgattcttgactgggta
gtcgggcatttcccgaccgattcgcacggtttaaccgagtttgacggctcgcatttatat
gaacatcaagatccgcgagaaggttatcatcaagattggaataccttaatttttaattac
ggtcgtcacgaggtgtttaattatctttccagtaacgccttatattggacggaacgattc
ggtatcgacggtttacgtgtcgatgcggtttcttccatgatttaccgcgattattctcgt
aaagacggcgagtggattccgaatcaatacggcggacgagaaaatttagaagcgcttgat
ttccttcgtagaaccaatcggatgttgaaaaaagaaggacacggagcggttgtgattgcg
gaagagtccacttcattcgccggtattacgcatagccctacggaaaacggggtcggtttc
gactataaatggaacatgggctggatgaacgataccttacgttatatgtcgctcgatccg
atttatcgtcaatatcatcacgattggatgaccttcgggatgatgtatcaatatagcgaa
aaattcgtattaccgctttcacacgatgaagtggtgcatggtaaatgttccattctcggg
aaaatgtcaggcgattgttggcaaaaatttgcgaacttaagagcttattacggttatatg
tggggctatccgggtaaaaaattactgtttatgggtaatgaattcgcccaaggtcgtgaa
tggaattacaacgaaagcctcgattggttcctgttaggcgaacaaggcggcggttggcat
aaaggcgtgctgaattgggtgagagatttgaaccgtacttaccaaaaatatccggcgctt
tatcaattggattacgatcctgccggttttgaatggttagtagtcgatgactggcaacaa
tcggtatttgcttttgaacgtaaagccaaaaacggcgagagtgtgatcgtagtcagtaac
tttacgccggtcgttcgccataattatcgtatcggcgtgcgtcaagacggcacttatact
gaaatcctcaattcggatgcggcttactatgaaggaagtaacgtaggcaattacggcgag
attgaatgcgaagcaatcgaatcgcacggtaaaccgttctctattgaactttcgattccg
ccgttatcaaccatttttattgcttgtcagcctaagcctaaagaagcggttgaagccgaa
caagatattgtgaaaatggcggaagttgcgatgcaaaaagcattaaaacccactaaaaaa
acggtaagcgtaaaagctaaagcacataaaaaagctcataaaaataagaagtaa

DBGET integrated database retrieval system