KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0399Help
Entry
APP7_0399         CDS       T00717                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    APP7_0399
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     APP7_0399
Exosome [BR:apa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APP7_0399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
452885..454396
Genome map
AA seq 503 aa AA seqDB search
MTKEYIIALDQGTTSSRAVLLDKNANIVEVSQREFTQIYPQVGWVEHNPMEIWATQSSTL
NEVVAKAGITSDKIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADICAKLKEDGH
EAYIRKTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRVHV
TDYTNASRTMMFNIHTKQWDDKMLELLNIPRSMLPEVRNSSEVYGETNIGGKGGVRIPVA
GMAGDQQAALYGHLCVEAGQAKNTYGTGCFMLMNTGNEAVESKNGLLTTIACNAKGEPCY
ALEGSIFMGGASIQWLRDELKIVHDSKDSEYFATKEDSTNGVYVVPAFTGLGAPYWDPYA
RGAILGLSRGANRNHIVRATLESIAYQTRDVLDAMQSDSGKHLATLRVDGGAVANNFLMQ
FQADILNANVERPVVREVTALGAAYLAGLAVGFWKDLQELRGKASIERTFVPDGDEAKRT
RRYKGWKKAVKRALEWAKEDAEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaatacattattgcgttagaccaaggtacgacaagctctcgtgcggtgtta
ctcgacaaaaacgccaatatcgtagaggtttctcaacgtgaatttacccaaatttatccg
caagtcggttgggtggaacataacccgatggaaatttgggcgacgcaaagttcgacatta
aatgaagtggtggcaaaagcgggcattacttccgataaaattgcggcaatcggtattacc
aaccaacgtgaaactacgattgtatgggaaaaagaaaccggtaaaccggtttataatgcg
attgtatggcaatgccgtcgtacggcggatatttgtgcgaaattaaaagaagacgggcat
gaagcttatattcgtaaaacgaccggtttagtggtggacccgtatttctccggtacgaaa
gtaaaatggattttagataatgttgaaggcgcaagagaaaaagccgagcgcggcgagctg
ttattcggtacggtagatacttggttggtttggaaattaacccaaggtcgcgtgcacgtt
accgattacacaaacgcttcccgtactatgatgttcaatattcataccaaacaatgggac
gataaaatgttggaattattaaatattccgcgttctatgttaccggaagtaagaaattca
tcggaagtttacggcgaaaccaatatcggcggtaaaggcggcgtacgtattccggtagcc
ggtatggcgggcgaccaacaagcggcgctttacggtcatttatgcgtagaagccggtcag
gcgaaaaatacttacggtaccggttgctttatgttgatgaataccggtaatgaagcggtc
gaatcgaaaaacggtttgctgactaccatcgcatgtaacgcaaaaggcgaaccgtgctat
gcgttggaaggttcgatttttatgggcggtgcttcgattcagtggttacgtgacgaactt
aaaatcgtacatgacagtaaagactccgaatattttgcaacaaaagaagacagcacaaac
ggtgtgtatgtcgtaccggcgtttaccggcttaggcgcgccgtattgggatccgtatgct
cgaggtgcgattttaggactttctcgcggtgcaaaccgtaaccatatcgtacgtgcgaca
ttagagtctatcgcatatcaaacccgtgacgtattggatgcgatgcaatcggatagcggt
aaacatcttgcgactttacgtgtggacggcggtgcggttgccaataacttcttaatgcaa
tttcaagcggatattctcaatgctaacgtagaacgtccggtcgtgcgtgaagttaccgct
ttaggtgcggcatatcttgccggtcttgctgtaggattctggaaagacttgcaagaatta
cgcggtaaagcgtcgattgagcgtacctttgttccggatggcgacgaagcaaaacgtacc
agacgttataaaggttggaaaaaagcggttaaacgtgcgttagaatgggcaaaagaagac
gcagaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system