KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0430Help
Entry
APP7_0430         CDS       T00717                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00900  Terpenoid backbone biosynthesis
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APP7_0430 (dxr)
Enzymes [BR:apa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     APP7_0430 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACE61082
UniProt: B3H0S0
Position
491924..493120
Genome map
AA seq 398 aa AA seqDB search
MDMKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMTTQCLLFQPKFAALDD
ENAAKALVEQLRQLNVKTEVLSGQKAICELSAHPEVDMVMAAIVGAAGLLPTLSAVKAGK
KVLLANKESLVTCGQIFIDEARKSGAQLLPVDSEHNAIFQSLPPEAQQKVGFCPLAELGV
SKIILAGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWL
FNASAEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMCTPIAHTMAYPKRINAGVAPLD
FFKLKELTFIEPDFARYPNLKLAIDAFSEGQYATTAMNAANEVAVEAFLNERIRFIDIVN
VNRTVVENIAPVQVKEIADVLHIDKLARELAEQAVINL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaaaaaattagtcattttaggttcaaccggttcaatcggtaaaagtacctta
tcggtggtggaacagaacaaaaccgaatacgaagtattcggtttggtcggcggtaaaaac
gttgaattgatgacgacgcaatgcttattgtttcaaccgaaatttgccgcattagatgat
gagaacgccgcaaaagcattggtggaacagcttagacaattgaatgtaaaaaccgaagta
ttaagcggtcaaaaagcgatttgtgaattgagcgctcaccccgaagtggatatggtgatg
gcggcgattgttggggcggcaggcctgttaccaacgctttcagcggttaaagctggtaaa
aaagttttattggcaaataaagaatcattagtcacttgcgggcaaatctttattgatgag
gcgagaaaatccggcgcgcagttattaccggttgatagtgaacataatgcgattttccaa
tccctaccgccggaagcacagcaaaaagtcggtttttgcccgcttgccgagttaggcgtg
agtaaaattattttagccggttctggcggtcctttccgtgtgaaaccgttagacgaattt
gcagcgattacaccggcacaagcggttgctcacccgaattggtctatgggtaagaaaatc
tcggtcgatagtgccacgatgatgaataaaggcttggaatatattgaagcccgttggtta
ttcaatgcgtcggcagaggagatggaaattattattcatccgcaatcgattattcattcg
atggtacgttatattgacggttccgttattgctcaaatgggtaatccggatatgtgtacg
ccgattgcacatacgatggcgtatccgaagcgcattaatgccggcgtggctccgttagat
ttctttaaattgaaagaattaacctttatcgaaccggactttgctcgctatccgaattta
aaattagcaattgatgcgttttcggaaggtcagtatgcgacaactgcaatgaatgcggca
aatgaagtggcggttgaggctttcttaaacgagcgtattcgttttattgatattgtgaac
gtgaatagaacagtggtggaaaatattgcaccggttcaagtgaaagaaatcgccgatgtg
ttacatatagataaattggcacgagaattggcggaacaagcggtcattaatttataa

DBGET integrated database retrieval system