KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0529Help
Entry
APP7_0529         CDS       T00717                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00020  Citrate cycle (TCA cycle)
apa00640  Propanoate metabolism
apa00660  C5-Branched dibasic acid metabolism
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01120  Microbial metabolism in diverse environments
apa01130  Biosynthesis of antibiotics
apa01200  Carbon metabolism
Module
apa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APP7_0529 (sucC)
   00640 Propanoate metabolism
    APP7_0529 (sucC)
   00660 C5-Branched dibasic acid metabolism
    APP7_0529 (sucC)
Enzymes [BR:apa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     APP7_0529 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACE61181
UniProt: B3GX29
Position
complement(594170..595336)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQIFAQYRLPVSKGIVCHSLDDAVSAIHTLAGDTWAAKCQVHAGGRGKAGGV
KLVRSEAEIREFCNQWLGQRLVTFQTDKNGQPVNTIYLEETCLIERELYLGAVIDRSSQK
IVFMASNAGGMNIEDVAAQTPELIHKATIDPLTGAQAFQGRELAFKLGLSGDQIKQFAHL
FVQLAKLFIEKDLALLEVNPLVLTKQGQLLCLDAKMVIDSNALYRHPELKALQDPSQEDA
READAAKWDLNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGRPANFLDVGGGATKERVSE
AFKLILSDQNVKAVLVNIFGGIVRCDLIAEGIIAAVNEVGINIPVIVRLEGTNAELGREI
LANSSLRLIAANTLTQAAQLAVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacacgaatatcaagcaaaacaaatttttgcacaatatcgacttcccgtaagt
aaaggtattgtttgtcattctctcgatgacgccgtttcagccattcacacattagcaggc
gacacttgggcggcgaaatgccaagttcacgccggcggtagaggcaaagcgggcggagta
aaattagtgcgcagtgaagcggaaattcgtgagttttgtaatcaatggttgggacagcgt
ttagtcacttttcaaaccgataaaaacggacaaccggtaaatacgatttatctcgaagaa
acgtgcctaatagaacgtgaattatatttgggtgcagtaattgatcgttcttcacaaaaa
attgtttttatggcatcaaatgccggcggtatgaatattgaagatgtcgccgcacaaaca
ccggagcttatccataaagcaaccattgatccgcttaccggtgcgcaagcttttcagggt
cgtgaattagcttttaaactcggtctgtccggcgatcaaatcaaacaattcgctcatctt
tttgtacaacttgccaaattatttattgaaaaagatcttgccttactcgaagtaaatccg
ctcgtattgaccaaacaaggtcaattactttgtttagatgccaaaatggtaattgacagt
aatgcgctttatcgccatccggagctaaaagccctacaagatccaagccaagaagatgcg
cgagaagccgatgcggcaaaatgggatcttaactatgtcgcattagacggcaatatcggt
tgtatggttaatggtgcaggcttagccatgggaaccatggatatcgtgaaactacacggt
ggccgtccggcaaactttttagatgtcggcggcggcgcaacgaaagaacgtgtttcggaa
gcctttaaactgattctttccgatcagaatgttaaagccgtcttagtcaatattttcggc
ggcatcgtcagatgcgatttaattgcggaaggtattattgcggcggttaatgaagtcggg
ataaacattccggtcatcgtgcgtttagaaggtactaatgcggaattaggtcgtgaaatt
ttagcaaacagcagcttacgtctcattgcggcaaatacattaacacaagcggcacaactt
gcagtcaaagcagcggaaggaaaataa

DBGET integrated database retrieval system