KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0531Help
Entry
APP7_0531         CDS       T00717                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00020  Citrate cycle (TCA cycle)
apa00310  Lysine degradation
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01120  Microbial metabolism in diverse environments
apa01130  Biosynthesis of antibiotics
apa01200  Carbon metabolism
Module
apa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APP7_0531 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    APP7_0531 (sucB)
Enzymes [BR:apa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     APP7_0531 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Hep_59
Motif
Other DBs
NCBI-ProteinID: ACE61183
UniProt: B3GX31
Position
complement(596489..597718)
Genome map
AA seq 409 aa AA seqDB search
MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS
QEQGATVTSKQLLGKISTVQAGDFTQETIKQTNEATPADRKSAAIEYDHSDADSQGPAIR
RLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAMASEHNTVSTVAYSARSE
KRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMADIE
KTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPV
AVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattttaactcccgtgctacccgaatccgtcgcggatgctaccgttgcg
acttggcacaaaaaagtaggcgatacggttaaacgtgacgaagtacttgttgaaattgaa
acggataaagtcgttttagaagtgccggcaccgaatgacggcgtattagcggaaatcagc
caagagcaaggcgcaaccgttacttctaaacagttacttgggaaaatctcaaccgttcaa
gcgggagattttacgcaagaaactatcaaacaaactaacgaagcgactcccgccgatcgt
aaatccgccgccatcgaatatgatcactcggatgccgactctcaaggtccggcaattcgt
cgtttattagcggaacataatatcgaagcgcatttagtcaaaggtaccggtgtcggcggt
cgtattacccgtgaagatatcgaacactatcttgcacaacgtcaggttcaagaaaccaaa
caagcgatggcaagcgaacacaatacggtaagtaccgtagcttactccgctcgtagcgaa
aaacgcgtgccgatgacacgtttgcgtaaacgtattgccgaacgtctgttagaagcgaaa
aacactactgcaatgctgactaccttcaacgaagtggatatgcagccgattatgagctta
cgtaaaacttacggtgagaaatttgaaaaacaacacggcgtgcgtttaggctttatgtca
ttctatattaaagcggtggtagaagcgttaaaacgttatccggaaatcaatgcttcgatt
gacggcgatgatgtggtatatcacaactacttcgatattagtattgcggtatccactccg
cgcggattagtcacgccggtgattcgtaactgcgataaattatcgatggcggatattgag
aaaaccattaaagcacttgccgaaaaaggacgtgacggtaaactaaccgtagaagaccta
accggcggtaactttaccattactaacggcggcgtattcggttcgttaatgtccactccg
attatcaatccgccgcaaagtgcgattttaggtatgcatgcgattaaagatcgccctgtc
gcagtaaacggtcaagtggtgattcgtccaatgatgtatcttgccttgtcttatgaccac
cgcttaattgatggacgtgaatctgttggtttcttagttgcggtcaaagatttattagaa
gacccgacccgtttactacttgaaatctaa

DBGET integrated database retrieval system