KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0535Help
Entry
APP7_0535         CDS       T00717                                 

Gene name
dsbC
Definition
(GenBank) thiol:disulfide interchange protein DsbC precursor (EC:5.3.4.1)
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Brite
Enzymes [BR:apa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     APP7_0535 (dsbC)
Chaperones and folding catalysts [BR:apa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   APP7_0535 (dsbC)
Secretion system [BR:apa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APP7_0535 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
603404..604099
Genome map
AA seq 231 aa AA seqDB search
MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDSALPGFRTAVSNEGVV
QISENGRFVIQGQIFELKNGKAVNITNKSLLADLNALEKEMIIYPAKNEKHVVTVFMDIT
CHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQMEAIWTSADKVKALTDAENGTL
PKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEPKELLKMLSE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatgtaacggcattattttccgtttctttaatgggcttatgcgtatctccc
gtgatggctgatgatatgagcttggtaaaaacgttagaagggatgggggcaacgaatgta
aaaatcagtgattcggcgctgcccggttttagaaccgccgtttcaaatgaaggcgtggta
caaatcagtgaaaacggacgttttgtgatccaagggcaaatttttgaactgaaaaacggc
aaagcggttaatattactaacaaatcattgttagcggatttaaatgcattggaaaaagag
atgattatttatccggcaaaaaatgagaagcacgtagttaccgtatttatggatattacc
tgtcattattgccatttaatgttccaacgtattaaagagtataacgatttgggtattacc
attcgtttcctcgctttccctcgcggcggaatgaatacacaaaccgcaaaacaaatggaa
gcgatttggacatcggcggataaagtgaaagcattaaccgatgcggaaaacggtacttta
ccgaaagaagtaaaaacaccgaatatcgtgaaaaaacactatgaactcggcattaaattc
ggcgtaacaggtaccccgaatatggtcgatagcaccggtcaattgatagccggttatgta
gaacctaaagaattacttaaaatgttaagcgaatag

DBGET integrated database retrieval system