KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0546Help
Entry
APP7_0546         CDS       T00717                                 

Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APP7_0546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APP7_0546
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APP7_0546
Enzymes [BR:apa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APP7_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614390..615580
Genome map
AA seq 396 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEETFVAAQNDPLFQAEFTDLLKNYAGRPTAL
TLCRNLTKGSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDLPCVIYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWAA
NYETTHYLIGTAAGPHPFPTMVREFQKMIGEETKRQILEKENRLPDAVIAAVGGGSNAIG
MFAGFIEEKSVQLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQTKDGQIEESYS
ISAGLDFPSVGPQHAYLNASGRADYVSITDKEALDAFQALAQHEGIIPALESSHALAYAL
KLIAQNPDKEQLLVVNLSGRGDKDIFTVDKILNGGN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaatccttatttcggcgaatttggcggaatgtatgttccggaa
attctcgtgccggtcttaaaacaactcgaagagacatttgttgctgcgcaaaatgatccg
cttttccaagcggaatttactgacttactgaaaaactacgccggtcgtccgaccgcatta
acgctttgccgtaatctcaccaaaggaagtaaaaccaaactttatcttaaacgtgaagat
ctgttacatggcggcgcacataaaactaaccaagtattagggcaagccctgttagcaaag
cgtatgggcaaaactcgcattattgcggaaaccggtgccggacaacacggggtggcaacc
gcattggcgtgtgcaatgttagatttaccttgtgtgatctatatgggtgctaaagatgtg
gaacgccaatcaccgaatgtattccgtatgcgtttgatgggtgcagaagtgattccggta
caaaaaggctcttgttcattaaaagatgcctgctgtgaagcaatgcgtgactgggcggca
aactatgaaacgacacattatttaatcggtacggcggcaggcccgcacccgttcccgacc
atggtgcgtgaatttcagaaaatgatcggcgaagaaaccaaacgacaaatattagaaaaa
gagaaccgcttaccggatgcggtgattgctgcggttggcggtggctcgaatgccatcggt
atgttcgcaggttttattgaggagaaaagcgtgcagctgatcggtgtagaaccggctggc
aaaggcattgaaaccggcgaacacggcgcaccgcttaaacatggtaccaccggcatttat
ttcggaatgaaatcgccgattatgcaaactaaagacggtcaaatcgaagaatcttattcg
atttcggcagggctggatttcccgtcagtcgggcctcaacacgcctatttaaatgcctca
ggcagagcggattacgtatctattactgataaagaagcgttagatgctttccaagcgtta
gcacagcatgaaggtattattccggcacttgaaagctcacacgcactggcttatgcgctg
aaattaattgcacaaaatccggataaagaacaacttttggtggtgaatctctccggtcgt
ggcgataaagatatttttaccgtagataaaattttaaatgggggaaactaa

DBGET integrated database retrieval system