KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0691Help
Entry
APP7_0691         CDS       T00717                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APP7_0691
   00052 Galactose metabolism
    APP7_0691
   00500 Starch and sucrose metabolism
    APP7_0691
   00520 Amino sugar and nucleotide sugar metabolism
    APP7_0691
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     APP7_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(770709..771596)
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSIVPKDVTLMHVRQGQAKGLGHAVLCGRAVVGN
EPFAVVLPDVILADFTANQKTENLAAMIKRFNETQHSQIMVAPVPREDVSSYGVADCAGV
EIPAGETAKIVKMVEKPSVEEAPSNLAVVGRYVFSAGIWDLLEKTPVGVGDEIQLTDAID
MLIEQETVEAFHMTGRTFDCGDKLGYMQAFTEYSLRHDKFGNDFKEFIKKLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattattccggtagcgggtttagggacgcgaatgcttcctgcaacaaaagcg
attccaaaagaaatgctgacgattgcggataaaccgcttattcaatatatcgtgaacgaa
tgtgtagcggctggtattaaagagatcgtattagtgactcattcttcaaaaaatgctatc
gaaaaccattttgatacgtcttttgaacttgaaactatgttggaaaaacgtgttaaacgc
caattattagaagaagtgcgctcaattgtgccaaaagacgttacattaatgcatgtacgt
caaggtcaagctaaaggtttaggtcatgcggtattatgcggtagagcggtagtcggtaac
gaaccttttgcagtcgtattaccggatgtaattttagccgattttactgcgaatcaaaaa
acggaaaaccttgcggcgatgatcaaacgtttcaacgaaacacaacatagccaaattatg
gttgcaccggtaccgagagaagatgtaagtagctatggcgtagcggattgtgcaggcgtg
gaaattcctgccggcgaaactgcaaaaatcgtgaagatggttgaaaaaccgagtgtagaa
gaagcaccttctaatttagcggttgtcggtcgttacgtattctccgcaggtatttgggat
ttattagagaaaacaccggttggtgtaggcgatgagatccaattaaccgatgctattgat
atgttaattgagcaagaaacggtagaagcatttcatatgacaggtcgtactttcgactgc
ggcgataaattaggttatatgcaggcatttaccgaatatagtttacgtcatgataagttc
ggcaatgactttaaagaatttattaaaaaattagctaaaacgttataa

DBGET integrated database retrieval system