KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0833Help
Entry
APP7_0833         CDS       T00717                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APP7_0833
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_0833
   00020 Citrate cycle (TCA cycle)
    APP7_0833
   00620 Pyruvate metabolism
    APP7_0833
Enzymes [BR:apa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APP7_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(926400..928298)
Genome map
AA seq 632 aa AA seqDB search
MSKQINVPDIGSDEVSVTEVMVKAGDTITVDQSIINVEGDKASMEVPAPEAGVVKEVLVK
VGDKVTTGSPMLVLEAAESAPAPVAEAPVQAVAPVATASAVVEVNVPDIGSDEVNVTEIM
VKVGDSVEVDQSIINVEGDKASMEVPAPIAGVVKEILINVGDKVTTGKLIMKFETVSAAP
AAEEAPAQAAAPVATASAIKEVNVPDIGGDEVNVTEIMVNVGDTVSEEQSLITVEGDKAS
MEVPAPFAGVVKEILVKSGDKVSTGSLIMKFEVAGAAPAAAPAPAAQAAAPAPAAQPAAQ
PAQSGNVSGLSQDVVAAAGAYAHATPVIRRLAREFGVNLDKVKGSGRKGRIVKEDIQTYV
KTAVQVFEKQGGTAAAATGAANGAGLGLLPWPKVDFSKFGEVEEVELSRINKISGANLHR
NWVMIPHVTHFDRTDITDLEAFRKEQNKLAEKQKLDVKITPVVFIMKAVAKALEAFPRFN
SSISEDAQRLTLKKYINIGVAVDTPNGLVVPVFKNVNKKGIVELSRELMEVSKKARDGKL
TASDMQGGCFTISSIGGLGTTHFTPIVNAPEVAILGVSKSEMAPVWNGKEFEPRLMLPLA
LSFDHRVIDGADGARFLTYINGVLADIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattaatgtgccagacatcggttcggatgaagttagcgtaaccgaagtc
atggtaaaagcaggcgatacaattactgttgatcaatcgattattaatgtagaaggcgac
aaagcttcaatggaagttccggcgccggaagcaggtgttgttaaagaagttttagtaaaa
gtcggcgataaagttacaaccggttcaccaatgctagtattagaagcggcggaatctgcg
ccggctccggtagcggaagcgcctgtacaagccgtagcgcctgtggcaacagcatcagcg
gttgttgaagtgaacgtaccggatatcggttcggacgaagtaaacgtaaccgaaattatg
gttaaagttggtgattcggttgaagttgatcaatcaatcattaatgtagaaggtgataaa
gcttcaatggaagttccggcacctatcgcaggcgttgtaaaagaaattttaatcaatgta
ggcgataaagtaacaaccggcaaattaattatgaaatttgaaacggtttcagcagcgcca
gctgcagaggaagcaccggcacaagctgccgcaccggttgcaacagcttcagcaatcaaa
gaagtaaatgtaccggatatcggcggtgacgaagtaaacgtaaccgaaatcatggtaaac
gttggcgatacggtatcagaagagcaatctttaattaccgttgaaggcgacaaagcttca
atggaagttccggctccgtttgcaggtgtggtaaaagaaattttagtaaaatcgggcgat
aaagtttcaaccggttcattaattatgaaatttgaagtagcaggtgcggcaccggcagca
gctcctgctcctgcagcacaagcagctgcaccagcaccagcggcacaaccggcagcgcaa
ccagctcaaagcggtaacgtttcaggtctaagtcaagatgtggtggcagcggcaggtgct
tatgcacacgcaacaccggtaattcgtcgcttagcgcgtgaattcggcgtgaacttagat
aaagtgaaaggctctggtcgtaaaggtcgtatcgttaaagaagatatccaaacatacgtt
aaaacggcagttcaagtatttgaaaaacaaggcggaacggcagcggctgcaacaggtgcg
gcgaatggcgcaggtttaggtttattaccatggccgaaagtggacttcagcaaattcggt
gaagttgaagaagtagaattaagccgtatcaataagatttcaggtgcgaacttacaccgt
aactgggtaatgattcctcacgttacacacttcgaccgtacggatatcacagatttagaa
gcattccgtaaagaacaaaataaacttgcggaaaaacaaaaattagatgtgaagatcaca
ccggttgtattcattatgaaagcggttgcgaaagcgttagaagcgttcccacgtttcaac
agttcaatctctgaagatgcacaacgtttaaccttgaaaaaatacatcaatatcggcgtg
gcggtagatactccgaacggcttagttgttcctgtatttaaaaatgtgaacaaaaaaggt
attgtcgagctttctcgcgagttaatggaagtatcgaagaaagcgcgtgacggtaaatta
accgcatcggatatgcaaggcggatgtttcacgatttcaagtatcggcggtttaggtaca
acacacttcactccaatcgtgaatgcaccggaagttgcaattttaggcgtatctaagtct
gaaatggcaccggtatggaacggtaaagaattcgaaccgcgcttaatgcttccgttagcg
ttatcattcgaccaccgtgtaatcgacggtgctgacggtgcaagattcttaacctacatc
aatggtgtattagcggacatccgtcgcttagttatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system