KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0889Help
Entry
APP7_0889         CDS       T00717                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APP7_0889
   01230 Biosynthesis of amino acids
    APP7_0889
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_0889
  Energy metabolism
   00680 Methane metabolism
    APP7_0889
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APP7_0889
Enzymes [BR:apa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     APP7_0889
Exosome [BR:apa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   APP7_0889
  Exosomal proteins of melanoma cells
   APP7_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999370..1000053
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGIEEAKSAGQKLKAAGYEFDIAFTSVLTRA
IKTCNIVLEESNQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDAADPNSAHNDRRYAHLPKDVIPNAENLKITLERVLPFWEDQIAPALLSGKRVLVTA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNFVEKFYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttattcgtcacggtttcagtgaatggaatgctaaaaacttatttaca
ggctggcgtgatgttaatttaaccgaacgtggtatcgaagaagcgaaatcggcaggtcaa
aaattaaaagccgccggttatgaattcgatatcgcattcacttcggttttaactcgtgca
attaaaacttgtaatatcgtattagaagaatctaatcaattatggattccacaagtgaaa
aactggcgtttaaacgagcgtcactacggtgcgttacaaggtttagacaaaaaagcgacc
gccgaacaatacggtgacgaacaagttcacatttggcgtcgctcttatgacatttctcca
ccggatttagatgcggcggatccgaattctgcgcataacgatcgtcgttacgcacactta
ccgaaagatgtcattccaaacgcggaaaacctcaaaatcactttagaacgtgttttaccg
ttctgggaagatcaaatcgcaccggcgttattatccggcaaacgcgtactggtaactgca
cacggtaactctcttcgtgcgttagcaaaacacatcatcggtatttctgatgctgaaatt
atggattttgaaatccctaccggtcagccgttagtattaaaattagatgataaattaaac
ttcgtagaaaaattctatttataa

DBGET integrated database retrieval system