KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0918Help
Entry
APP7_0918         CDS       T00717                                 

Gene name
trpCF
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01130  Biosynthesis of antibiotics
apa01230  Biosynthesis of amino acids
Module
apa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APP7_0918 (trpCF)
Enzymes [BR:apa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     APP7_0918 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     APP7_0918 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ACE61570
UniProt: B3H1J8
Position
complement(1033377..1034786)
Genome map
AA seq 469 aa AA seqDB search
MQNQPTILQKIVQDKAVWVDNKQKTFPLSQFQQQIVTADRDFYAALAAASHQVPAYILEC
KKASPSKGLIRAEFDLDAIAQVYKHYASVISVLTDEQYFQGDFRYIEQVKRQTMQPILCK
DFMISPYQVYLARYSNADAILLMLSVLDDETYRTLADLAHSLGMGVLTETSTEQEFERAL
ALGAKVIGVNNRDLHTLTVDMNRIVRLVEKYQDQIPADVRLISESGIYDHSQVKAIKPFA
HAFLIGSSLMGSADLNNAVRSVIFGENKVCGLTRPQDVKAVYENGFLYGGLIFAENSPRQ
LSLRQAQELVVNAPLRYVGVFQNQAVEFVEKIAKQLELYAVQLHGTEDEAYITKLSEKLA
GKTQIWQAISVDVQAETVEYHDNPLVARYILDSKHGAQQGGTGRVFDWQIISSELKPKAL
LAGGISAENIEQALVQGCLGVDLNSGVEQHKGVKDLAKMTACAEKILKA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccaacctactattctgcaaaaaatcgtacaagataaggccgtttgggtcgat
aacaaacaaaaaacctttccactttcgcaattccaacagcaaattgttaccgctgatcgg
gatttttatgccgcactggctgcggcttcacatcaagtaccggcttatattttggaatgt
aaaaaagcctcgccatccaaaggcttgattcgtgccgaatttgatttagatgcgattgcg
caggtctataaacattacgcttccgtgatttccgtactgaccgacgaacaatatttccaa
ggcgattttcgttatatcgagcaagttaaacgccaaacaatgcaaccaatcttatgcaaa
gattttatgatttctccgtatcaggtgtatttggctcgttattcaaatgcggatgcgatc
ttgttaatgctctcggtattagatgacgaaacgtatcgcacattggcggatttagctcac
tcattaggtatgggcgttttaaccgaaaccagtaccgagcaagaatttgagcgagcgtta
gcattaggtgcaaaagtgattggcgtgaataaccgtgatttacatacgctgacggtggat
atgaatcgcattgtacgtttagtcgaaaaatatcaggatcaaattccggcagatgtccgt
ttgatttccgaatcgggtatttatgatcattcgcaagtgaaagcgattaagccgtttgcg
cacgcatttttaatcggcagcagcttaatgggcagtgccgatttaaataatgcagtacgt
tcggtgatcttcggtgaaaataaagtgtgcggattaactcgcccacaagatgtcaaggca
gtgtatgaaaacggctttttatacgggggattaatttttgccgaaaattcgcctcgccaa
ttatcactacgccaagcacaagaattagtcgtgaatgcaccattgcgttatgtcggtgtg
ttccaaaatcaagcggttgaatttgtcgaaaaaatagcaaaacagcttgagttatatgcg
gtgcagttgcacggtacggaagatgaagcctatattaccaaattgtctgaaaaattagcc
ggaaaaacgcaaatctggcaggcaatttcggtggatgttcaggcggaaacggttgagtat
cacgataatccgttagtggctcgttatattctggatagcaaacacggtgcgcaacagggc
ggtacgggtagggtgtttgactggcagatcatttcaagcgaattaaaaccaaaagcactg
cttgccggtgggatttcggctgaaaatatcgaacaggctctagtacagggctgtttaggc
gttgatcttaattccggtgtagagcagcataaaggcgtaaaagatttagcaaaaatgacc
gcttgtgcggagaaaattctcaaagcctaa

DBGET integrated database retrieval system