KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0943Help
Entry
APP7_0943         CDS       T00717                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APP7_0943
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APP7_0943
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    APP7_0943
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APP7_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056843..1057934
Genome map
AA seq 363 aa AA seqDB search
MQKTIVIKFGTSTLTHGGKSLSRPYMLELVKQIAQLHQHHRVIVVTSGAAAAGRDYLGHP
ELPKTLAYKQMLAAVGQSQLIRTWENLFDIYGIHIGQILLTRADIDDRERFLNARDTLNA
LLEQRIIPVINENDTVATEEFKVGDNDNLSALVAILAHADQLYLLTDQEGLFDSDPRSNP
QAKLLSVVEKITPEIRQMAGGSVTGLGTGGMSTKITAADIATRSGVETVIASGSRANVLV
DLANGESIGSKFLVQSDRLEGRKQWLFAAPQVGSLVVDKGAEAALLQHKSLLPVGVSEIN
GVFSRGEVVKIFNQEGKALALGLARYNSDALIRIKGKKSKEIESLLGYEFGSVAVHIDEM
VIY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacaattgtgattaaattcggcaccagtactcttacgcacggcggaaagagt
ttaagccgtccttatatgctggaattagttaaacaaatagctcaacttcatcaacatcat
cgagtgattgtcgtcacctccggagccgcagcagccggcagagattatttaggtcatccc
gaacttcccaaaacactcgcctataaacaaatgcttgccgcagtcgggcaaagtcagcta
atccgtacttgggaaaatttattcgatatttacggcattcatatcgggcaaattttatta
acccgtgccgatattgatgatcgcgaacgttttttaaatgcgcgcgataccttaaatgcc
ttgttggagcaaagaatcattcctgtgatcaatgaaaacgatacggttgccaccgaagaa
tttaaagtcggcgataatgacaatctttccgcattggttgcgattctagcgcatgccgat
caactttatcttttaaccgaccaagaaggcttatttgattccgatccgcgttcaaatccg
caagcgaaattactgtccgtcgtggaaaaaatcacgcctgaaatccgccaaatggcgggc
ggtagcgtcactggactcggcaccggcggtatgagtactaaaattaccgccgccgatatt
gctacgcgttccggtgtcgaaaccgttatcgcttcaggctctcgtgcaaacgtattggtc
gatttagctaacggcgaatccatcggtagtaagtttttagtacaatccgaccgcttggaa
ggtcgtaaacaatggttattcgccgctccgcaagtcggctcgcttgtggtggataaaggg
gcggaagccgcattattacaacataaatcattactgccggtcggtgtttccgagattaac
ggcgtctttagccgaggcgaagtagtgaaaatttttaaccaagaaggtaaagcgcttgct
ttggggcttgctcgttataacagcgatgcgttaattcgtattaaaggaaaaaaatcgaaa
gagattgagtctctgctcggttatgaattcggttccgtcgccgtacatattgatgagatg
gtcatttattaa

DBGET integrated database retrieval system