KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_0947Help
Entry
APP7_0947         CDS       T00717                                 

Definition
fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APP7_0947
   01212 Fatty acid metabolism
    APP7_0947
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APP7_0947
   00650 Butanoate metabolism
    APP7_0947
  Lipid metabolism
   00071 Fatty acid degradation
    APP7_0947
   01040 Biosynthesis of unsaturated fatty acids
    APP7_0947
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APP7_0947
   00310 Lysine degradation
    APP7_0947
   00380 Tryptophan metabolism
    APP7_0947
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APP7_0947
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APP7_0947
   00281 Geraniol degradation
    APP7_0947
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    APP7_0947
Enzymes [BR:apa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APP7_0947
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APP7_0947
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     APP7_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1060880..1062997
Genome map
AA seq 705 aa AA seqDB search
MTEQPIQQPMFQVEVDENQIAIIRIHSIDNDENWLPENFAGELREVIGTLIYRQVQGAIF
ISTRANHFIQGLKPSLFKNKTNEQLLAFSQDAQAIMRELNTLKMPIVAAIDGNCFSVGLE
LSLACDYRIASDESHTFFAMPQVRSGLLPFAGGTQRLPRLIGLRSALPLMLFGEKITAET
AKGLGLVDRLVPKTRLLTDAYQLLLEKKIQKANHKKPLTFFKKWRKQIEGNSFLREKLLD
RTENAIWLKTFGNYPAVAKLMELLKEPHFKQGLILEQQAFVELFNSATSQVLIELKKTER
AMKDKYRIRGNVRDVAQVSILGSGYMGAGIAYLTANNAKVPVRIKDIHPSEIRKALRTCF
ELMQKATDKNQLNHGEMIQRMNLITGGERLVAAKSTDFVIEAVYEDLKLKQRMLAESESY
YSEQTIFATNTSTFAIKDIAACAIRPENVIGLHYFSPVTTQKMVEIIPHSATGEHTIATA
IHFAIQQGKIPLLVADKQGFFINRVLTPLLLEAVQCLIDGESIEFIDRSLQEFGFKLGPL
AMIDEMGLDVLVKSNSALVSELGSRFSLPQAVDLLFRNERKGCKNKRGFYMYDRFGERLQ
EDKSIYHVMETIARNDLESEQIVRRCLLRMLNEAAWCLQDKIIASTDEGNVASVLAMGFP
EFRGGIYAYIEKIGAKEIVRQLHLHTKQYGKRFEPCEWLIRQAEQ
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaacccattcagcaaccgatgtttcaagtcgaagtagatgaaaatcagatt
gccatcattcgcattcactctattgataatgatgaaaactggcttcccgaaaattttgcc
ggcgaattaagagaagttatcggtacgctgatttatcgtcaggtacaaggtgcgattttt
atttcgacacgggcaaatcattttattcagggcttaaaaccgagccttttcaaaaacaag
acaaatgagcaattacttgctttttcccaagatgcacaagcgattatgcgagagttgaat
acgctgaaaatgccgattgtcgccgctatcgacgggaattgctttagtgtcggtctggaa
ctttccttagcttgcgattaccgtatcgccagtgatgaatcgcatactttctttgcgatg
ccgcaagtccgttccggcttattaccttttgccggcggtacgcaacgtttaccgcgttta
atcggtttacgttccgcgctaccgttaatgttattcggcgaaaaaataactgccgaaacc
gccaaaggattgggtttggttgatcgattggttcctaaaactcgtcttttaaccgatgct
tatcaactcttactagagaagaaaattcaaaaagccaatcataaaaaaccgcttactttc
tttaaaaaatggcgtaagcagatcgaaggtaattcgttcttacgcgaaaaattgcttgat
cgtacggaaaatgcgatttggcttaaaacgttcggtaattaccctgcggttgccaaactg
atggaactgctcaaagagccgcactttaaacaagggttaatactcgaacaacaagccttt
gtcgaattgtttaatagcgcaacctcacaagtattaatcgaattaaagaaaaccgaacgg
gcaatgaaggataaatatcgtattcgaggtaatgtacgtgatgtcgctcaagtcagtatt
ttaggttcgggctatatgggcgccggtattgcttatttaaccgccaacaatgctaaagta
ccggttcgcataaaagatattcatccgtcggaaattcgtaaagccttacgtacctgcttt
gaattaatgcaaaaagcaacggataaaaatcagcttaatcacggtgaaatgatccaacgt
atgaatctgattaccggcggagagcgattagtggcggcaaaatcaaccgattttgtgatt
gaagcggtgtatgaagatctcaaacttaaacaacggatgttagccgaaagtgaaagctac
tatagtgaacaaaccatttttgcaacgaatacttcaacctttgcgattaaagatattgcg
gcttgtgcgattcgtccggaaaacgtaatcgggctacattatttcagcccggttaccacg
caaaaaatggtggaaatcataccgcatagcgcaaccggcgaacatacgattgcgacggcg
attcattttgccattcaacaaggcaaaatcccgttgttggttgctgataagcagggtttt
tttattaatcgagttttaacgccgttactgcttgaagcggtgcaatgtttaattgacggc
gaatcgattgaatttatcgatcgttcgttacaagaattcggcttcaaattaggcccgctt
gccatgatcgacgaaatggggctggatgtattggtcaaatcgaactcggctttagtcagc
gaattaggcagccgtttcagtttgcctcaagcggttgatttattgttccgaaatgaacgt
aaaggctgtaaaaacaaacgcggtttctatatgtatgatcgcttcggagaacgtttacag
gaagataaaagcatttatcacgtgatggaaaccattgcccgtaacgatttggaatccgaa
cagattgtccgccgttgcctgttacgtatgctcaacgaagcggcttggtgtttacaggat
aagattatcgcctcgaccgacgaaggtaatgtcgcttccgttctcgcaatgggctttccg
gagtttcgaggcggtatctatgcctatatcgaaaaaatcggtgcaaaagaaatcgtacgg
caattacacttacacactaaacaatacggtaaacgtttcgaaccttgcgaatggctaatc
cgacaagccgaacaataa

DBGET integrated database retrieval system