KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1050Help
Entry
APP7_1050         CDS       T00717                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    APP7_1050
  Lipid metabolism
   00600 Sphingolipid metabolism
    APP7_1050
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    APP7_1050
Enzymes [BR:apa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     APP7_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1180110..1183130
Genome map
AA seq 1006 aa AA seqDB search
MILPNYFQDPNTLHVNTVEHHAYFIPHQQNETALSGKREQSDYFTLLNGQWDFNYFQSYH
DLPDNFLDVAFEHKIPVPANWQNHGFDHHHYTNINYPFPFDPPFVPHQNPCGVYHRTVQL
TPKSNKRYLLNFEGVDSCLFVYVNKQFVGYSQISHNTSEFDVSDYLQAGTNHLTVVVLKW
CDGSYLEDQDKFRMSGIFRDVYLLEREQNYLQDFFIQYELDDELRHANLKVETLFSRQPQ
AIEYQLLNPKGFTVFNQTDTHLNIEVEDIQLWNAEKPQLYTLILRTAEEVIVQKIGFRKV
EIKDGILLFNQQPIKFKGVNRHDSDPKTGYAISYAQAHKDLQLMKQHNINAIRTAHYPNA
PWFSELCDQYGFYLIGESDVESHGASMLAVKTPEPSILLNHQNDLQTERIRQDMIDNYCY
FARDPLFKKAILDRQQANVERDKNRTSIIIWSLGNEAGYGANFEAAAAWIKQRDKSRLVH
YESSIYQHSADNNDLSNLDFYSEMYGSTEDIDRYCATAQAKPFVLCEYSHAMGNSNGDAE
DYWQAFHRHPQSCGGFVWEWCDHAPYRANGQFGYGGDFGESPHDGNFCLDGLVSPDRIPH
SNLLELKNVNRPARAELIDNQIVIHNYLDFTDLADYLTIDYEFVENGVVTSGGNLSVSCQ
PHGSVVLPIELPKNNGHLWLLNLNYRLNTAVELLDEAHSLGFEQLNLFSENKLVLPKFTI
ENSAFEVQEDRFHINVHNGQFSYQLDKQKGIFNRIEKAGKAIIQQSLDFNIWRAPTDNDR
LIREAWQNAGYDKAYTRAYEIQWQQSEQAVEFSVKSAIVSISRGRILTLDIRYRIFNDGQ
ISVEINAIRPTELPYLPRFGLRFWLAKAENTVEYFGYGEQESYVDKHHLANLGIYHTTAK
QNHTDYVKPQENGSHYGCEYLKSENLFVSASQPFSFNLSPYTQEELTAKKHCYELQESDY
SVLCIDYKMSGIGSNSCGPNLKDQYRLMESEFKIRFDLIFDKTIRQ
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgatactgccgaattacttccaagatcccaatacgctccacgtaaataccgttgagcat
cacgcttattttattccgcatcaacagaatgaaaccgctttaagcggtaagcgcgaacaa
tccgattactttactttgcttaacggacaatgggattttaattacttccaaagctatcat
gacctaccggataatttccttgatgttgcgtttgaacataaaattccggtgccggcaaat
tggcaaaatcacggttttgatcatcatcactatacgaatattaattacccgttcccgttt
gatccgccttttgtaccgcatcaaaatccatgcggcgtgtatcatcgtaccgtacaactt
accccgaaaagcaataagcgttatttgctcaattttgaaggcgtagattcctgtttattt
gtttatgtgaataaacagtttgtcggttatagtcaaattagccacaacacctccgaattt
gatgttagcgattatttacaagccggcaccaaccatttaaccgtcgtggtactgaaatgg
tgtgacggtagctatttagaagaccaagacaaattcagaatgtcaggcattttccgtgat
gtctatttgcttgagcgtgaacaaaattatctgcaagatttctttattcaatatgaattg
gatgatgaattacgtcacgcaaatctgaaagtggaaacactttttagccgtcagccgcaa
gcgattgaataccaattactcaacccgaaaggctttaccgttttcaatcaaaccgatacg
catctcaatattgaggtagaagatattcagttatggaatgccgaaaagccgcaactttac
accttaattttgcgtactgcggaagaagtgattgtgcaaaaaatcggttttagaaaagtg
gaaatcaaagacggcattttattatttaatcagcaaccgattaaatttaaaggagtaaac
cgccacgatagcgatccgaaaaccggttatgcgattagctacgcacaagcgcataaagat
ttacagctgatgaagcaacataatatcaatgcaatccgcaccgcccattatccgaatgcg
ccttggtttagcgagctatgcgatcaatacggtttttatttgattggcgaaagcgatgtc
gaatcgcacggcgcgtcaatgctggccgtcaaaacgccggaaccgagtattctcttaaat
caccaaaatgatttgcaaactgagcgtatccgccaagatatgattgataattactgttac
tttgcccgtgatccgctgttcaaaaaagcgattttagaccgccaacaagccaatgtggaa
cgagataaaaatcgtacttcgattattatttggtcgttggggaatgaagccggctatggt
gccaattttgaagcggcggcagcgtggattaagcaacgtgataaatctcgtttagtgcat
tacgaaagctcgatttatcaacattccgccgataataatgatctatcgaatttggatttt
tatagtgaaatgtacggctcaaccgaagatatcgaccgctattgtgccactgcgcaagcc
aaacctttcgtgttgtgtgaatacagccatgcaatgggtaactcaaacggcgatgcggaa
gattattggcaagcgttccatcgtcatccgcaatcatgcggcggttttgtgtgggaatgg
tgcgatcacgccccttaccgtgctaacggacaattcggttacggcggtgatttcggcgaa
agtccgcacgatggaaatttctgtctggacggtttggtttcaccggatcgtattccgcac
agtaacttattagagcttaaaaatgtgaatcgccctgcacgtgccgaattaatcgataac
caaattgtgatccacaactacttggatttcactgatcttgccgattatttaacgattgat
tacgaatttgtcgaaaacggcgtggtgacaagcggtgggaatttatccgtttcttgccaa
ccgcacggcagcgtagtattaccgattgagttaccaaaaaataacgggcatttatggcta
ctgaatttaaattatcgcttaaataccgcggtcgaattattagacgaagcgcattcactt
ggcttcgagcagctcaatttatttagcgaaaataaattagtattaccaaaattcacaatt
gagaacagtgcatttgaagtacaagaagatcgcttccacattaacgtacacaacggtcaa
tttagttatcaattagataaacagaaagggattttcaaccgtattgaaaaagccggtaaa
gcgattatccaacaatcgttagattttaatatttggcgtgcgccaaccgacaatgatcgc
ctcattcgtgaggcgtggcaaaatgccggctacgataaagcctataccagagcgtatgaa
attcagtggcagcaaagcgaacaagcggtcgaattttcagtaaaatctgcaattgtgtca
atttctcgcggtcgcattttaacactggatattcgttatcgtatcttcaatgacgggcaa
atttcggtggaaatcaacgcaatccgtccaaccgaattaccgtatttacctcgtttcggt
ttacgcttctggcttgctaaagcggaaaatacggtcgaatatttcggttacggcgagcaa
gaaagctatgtggataagcaccatttagcaaatttaggcatctatcatactacggcaaaa
caaaatcataccgattatgttaaaccgcaggagaacggcagccattacggttgcgaatat
ctcaaatcggaaaatctgtttgtgagtgcaagccaaccgtttagctttaatctctcgccc
tatacgcaagaggaattaacggcgaaaaaacattgctacgagctacaagaatccgattac
agcgtgctatgtatcgattacaaaatgagtggtatcggttcaaactcatgcggcccaaac
ttaaaagatcaatatcgcttaatggaaagcgaatttaaaataagatttgatctcatattt
gataaaaccatccgtcaataa

DBGET integrated database retrieval system