KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1066Help
Entry
APP7_1066         CDS       T00717                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APP7_1066
Enzymes [BR:apa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APP7_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1206665..1207429)
Genome map
AA seq 254 aa AA seqDB search
MNVLITRPDYRGQELVEMLNQYQIFAIHQPLFTIEAGTELPQLPSVMSRLNTDDYVFAVS
KHAIDFASETLVQTGFQYRSDLKYFAVGRQSAAYFSTKTAYPTYYPISSENSEGLLELPE
MQCLEGKNILVLRAEKGRDFFAEQASLRGANVQYLECYRRKYAEDNITEKMSLCKRAGID
SIIVTSSDILAALYEQTAELDRQWLIECRLIVVSSRIAQLAYKLGWGRNKVLLSEKADNN
SLLESVLKFIDKSN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttaattactcgccctgattatcgtgggcaggaattagttgaaatgttgaat
cagtatcagatttttgcgattcatcagccgttatttacgattgaagccgggacggaatta
cctcagcttccgtcggttatgtctcgtctgaatacggatgattatgtatttgccgtttct
aaacatgccattgattttgcttcggaaacgctcgtacagacaggttttcagtatcgttcc
gatttaaaatattttgcggtgggaagacaatccgcagcctatttttcgacaaaaacagcg
tatcctacgtattatccgatctcttccgagaatagtgagggattactggaattacctgaa
atgcagtgcttagaaggaaaaaatattctcgttttacgagcggagaaagggcgggatttt
tttgcggaacaagcgagtttacgaggagcaaatgtccaatatttagagtgttatcgtcgt
aaatatgcggaagataacattactgaaaaaatgagtttgtgtaaacgagccggcattgat
agtattatcgtgacaagttcggatattttagccgctttatacgaacaaacggcggaactc
gatcgtcagtggttgattgaatgtcgtttaatcgtcgttagctctcgtatcgctcaactg
gcgtataaattgggttggggtagaaataaggttctactgtccgaaaaagcggataataat
agtctgctggaaagcgtattgaaatttatcgacaaatctaactaa

DBGET integrated database retrieval system