KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1152Help
Entry
APP7_1152         CDS       T00717                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APP7_1152
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    APP7_1152
Enzymes [BR:apa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     APP7_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1298741..1299874
Genome map
AA seq 377 aa AA seqDB search
MKKAITLFTLLCAVLLSFSTATYANAMDLPKKESGLTLDIARRFYTVDTIKQFIDTIHQA
GGTFLHLHFSDHENYALESSYLEQREENATEKNGTYFNPKTNKPFLTYKQLNEIIYYAKE
RNIEIVPEVDSPNHMTAIFDLLTLKHGKEYVKGLKSPYIAEEIDINNPEAVEVIKTLIGE
VIYIFGHSSRHFHIGGDEFSYAVENNHEFIRYVNTLNDFINSKGLITRVWNDGLIKNNLS
ELNKNIEITYWSYDGDAQAKEDIQYRREIRADLPELLANGFKVLNYNSYYLYFVPKSGSN
IHNDGKYAAEDVLNNWTLGKWDGKNSSNHVQNTQNIIGSSLSIWGERSGALNEQTIQQAS
KNLLKAVIQKTNDPKSH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaattactttatttacattattatgcgcggtacttctctcattcagtacc
gcaacttatgcaaacgctatggacttacctaaaaaagaaagcggtctgacgttagatatc
gcacgtcgtttctataccgttgatacgataaaacaatttatcgatacgattcatcaggcg
ggcggcacttttctgcatttacatttttccgatcacgagaattatgcattggaaagttct
tatttggaacaacgagaagaaaatgcgaccgagaaaaacggaacctatttcaatccgaaa
acaaataagccgtttctcacttataaacagctcaatgaaattatctattatgccaaagaa
cgaaatattgaaattgtgcctgaagtcgatagcccgaatcatatgacggcgatttttgat
cttttaacccttaagcacggaaaggaatacgtaaaagggctaaaatcgccttatatcgcc
gaggaaatcgatattaataaccccgaagcggttgaagttattaaaaccttaatcggtgaa
gtgatctatattttcggacattcaagccggcatttccatatcggcggagatgaatttagc
tatgcggtcgaaaataatcatgaatttattcggtatgtgaataccttaaatgattttatc
aattccaaagggctaattacccgtgtttggaatgacggtttgatcaaaaacaacttaagc
gaactcaataaaaacattgaaatcacttactggagctacgacggtgacgctcaagccaaa
gaagatattcaatatcgacgtgaaataagagccgatttgcccgaactgctggcaaacggt
tttaaggttttaaactataattcttattatttatactttgtgcctaaatccggttctaat
attcacaatgacggtaaatatgcggctgaagacgtattaaataactggacattaggtaaa
tgggacggtaagaacagctcaaatcacgtacaaaatacgcagaatattatcggttcttct
ttgtcgatttggggggaacgttccggcgcattaaacgaacaaactattcagcaagcctct
aaaaatttattaaaagcggtaatccaaaaaactaatgatccgaaatcgcattag

DBGET integrated database retrieval system