KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1152Help
Entry
APP7_1152         CDS       T00717                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:apa00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:apa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1298741..1299874
Genome map
AA seq 377 aa AA seqDB search
MKKAITLFTLLCAVLLSFSTATYANAMDLPKKESGLTLDIARRFYTVDTIKQFIDTIHQA
GGTFLHLHFSDHENYALESSYLEQREENATEKNGTYFNPKTNKPFLTYKQLNEIIYYAKE
RNIEIVPEVDSPNHMTAIFDLLTLKHGKEYVKGLKSPYIAEEIDINNPEAVEVIKTLIGE
VIYIFGHSSRHFHIGGDEFSYAVENNHEFIRYVNTLNDFINSKGLITRVWNDGLIKNNLS
ELNKNIEITYWSYDGDAQAKEDIQYRREIRADLPELLANGFKVLNYNSYYLYFVPKSGSN
IHNDGKYAAEDVLNNWTLGKWDGKNSSNHVQNTQNIIGSSLSIWGERSGALNEQTIQQAS
KNLLKAVIQKTNDPKSH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaattactttatttacattattatgcgcggtacttctctcattcagtacc
gcaacttatgcaaacgctatggacttacctaaaaaagaaagcggtctgacgttagatatc
gcacgtcgtttctataccgttgatacgataaaacaatttatcgatacgattcatcaggcg
ggcggcacttttctgcatttacatttttccgatcacgagaattatgcattggaaagttct
tatttggaacaacgagaagaaaatgcgaccgagaaaaacggaacctatttcaatccgaaa
acaaataagccgtttctcacttataaacagctcaatgaaattatctattatgccaaagaa
cgaaatattgaaattgtgcctgaagtcgatagcccgaatcatatgacggcgatttttgat
cttttaacccttaagcacggaaaggaatacgtaaaagggctaaaatcgccttatatcgcc
gaggaaatcgatattaataaccccgaagcggttgaagttattaaaaccttaatcggtgaa
gtgatctatattttcggacattcaagccggcatttccatatcggcggagatgaatttagc
tatgcggtcgaaaataatcatgaatttattcggtatgtgaataccttaaatgattttatc
aattccaaagggctaattacccgtgtttggaatgacggtttgatcaaaaacaacttaagc
gaactcaataaaaacattgaaatcacttactggagctacgacggtgacgctcaagccaaa
gaagatattcaatatcgacgtgaaataagagccgatttgcccgaactgctggcaaacggt
tttaaggttttaaactataattcttattatttatactttgtgcctaaatccggttctaat
attcacaatgacggtaaatatgcggctgaagacgtattaaataactggacattaggtaaa
tgggacggtaagaacagctcaaatcacgtacaaaatacgcagaatattatcggttcttct
ttgtcgatttggggggaacgttccggcgcattaaacgaacaaactattcagcaagcctct
aaaaatttattaaaagcggtaatccaaaaaactaatgatccgaaatcgcattag

DBGET integrated database retrieval system