KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1168Help
Entry
APP7_1168         CDS       T00717                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APP7_1168
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    APP7_1168
Enzymes [BR:apa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     APP7_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320738..1321775
Genome map
AA seq 345 aa AA seqDB search
MLLIDIKDKELSQEEVEILEHPLVSGLILFSRNFHDKVQLEALVKSIRQRVKKPLLITVD
QEGGRVQRFREGFTKLPAMQAFHTLAKNPQESTALARQTGWLMAAEMFALDIDLSFAPVL
DLGHQCKAIGDRSFGENPDAMLPIAEAFIDGMREMGMATTGKHFPGHGHVLADSHLETPF
DDRPKEAIFNRDILPFKQLISKGKLSAIMPAHVIYTQCDSQPASGSEYWLKQVLRNQLNF
NGVIFSDDLGMKGAGFMGNFVERSEKAIHAGCDLLLLCNEPEGVIQVLDGLKYQPTKTQT
ERHISLMKRKTVRWNELEASPRYQQAQQRLTALQNDWLEYKAQHC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttattgattgatataaaagataaagaactcagccaagaagaagttgaaattcttgaa
catccgctcgtatccggcttaattttatttagccgtaattttcacgataaagtccaattg
gaagccttagtgaaatcgattcgccaacgggtaaaaaaaccgttattgattaccgtcgat
caagaaggcggtcgagtacaacgcttccgtgaaggctttactaagttgccggcaatgcaa
gcgtttcatacccttgcaaaaaacccgcaagaatcgaccgctttagcccgacaaaccggt
tggttaatggcggctgaaatgtttgccttagacatcgacttgagttttgcaccggtctta
gatttagggcatcagtgcaaagcgattggcgatcgttcgttcggtgaaaatccggatgcg
atgctaccgatagccgaagcctttatcgacggtatgagagaaatgggtatggcgaccacc
ggtaaacatttccccggtcatggacatgtattagccgactctcatttagaaacgcctttt
gatgatcgtccgaaagaggcgattttcaaccgtgatattctgccgtttaaacaacttatt
tcaaaaggtaaactgtccgcgattatgccggctcacgtaatttatacgcaatgtgacagc
caaccggcaagcggatcggaatattggttaaaacaagttttacgtaaccaacttaacttt
aacggcgtgattttttccgatgatttaggtatgaaaggcgccggttttatgggtaatttt
gtagaacgttctgagaaagcgattcacgccggttgtgatttactgctgctctgtaatgaa
ccggagggagttatccaagtattagacggtttaaaatatcaaccgactaaaacgcaaacc
gaacgccatatctccttgatgaaacgtaaaacggtacgttggaacgagcttgaagcgagt
cctcgttatcagcaagcgcagcaacgtttaaccgcattacaaaacgactggcttgaatat
aaagcgcagcactgctaa

DBGET integrated database retrieval system