KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1182Help
Entry
APP7_1182         CDS       T00717                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APP7_1182
   01230 Biosynthesis of amino acids
    APP7_1182
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_1182
   00030 Pentose phosphate pathway
    APP7_1182
   00051 Fructose and mannose metabolism
    APP7_1182
   00052 Galactose metabolism
    APP7_1182
  Energy metabolism
   00680 Methane metabolism
    APP7_1182
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     APP7_1182
Protein phosphatases and associated proteins [BR:apa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     APP7_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1333692..1334666)
Genome map
AA seq 324 aa AA seqDB search
MAKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRS
VSETINRGGTFLGSARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEF
GYPCIGIPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIEDGFNKGKRHAIIAITELMTDVQALAKEIE
DRFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGHGGRCIGIKNENLVHHD
IIDAINNMRRPFKEELFEAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaatcaaaaaaattgccgtgctaaccagtggaggtgatgcaccgggtatg
aatgccgcaattcgtggcgtagtccgcgccgcattaaacgaaggcttagaagtatatggc
gtacaagacggttattacggtttatataccgatagagtaattccgcttgatcgtcgttcc
gtatcggaaacgatcaaccgcggcggtacttttttaggttcggcgcgcttcccgcagttt
aaagatcctgacgtacgtaaaaaatcggtagaaaccttaaaaaaatacgatattgatgcg
ctggtcgttatcggcggagacggctcgtatatgggagcgaaacttataaccgaagaattc
ggttatccgtgtatcggtattccgggtacgatcgataatgatatcgtcggtacggattat
actatcggttaccaaaccgcattggaaacggcggtggaagcgattgaccgtttacgcgat
acttctacctcgcatcagcgtatttcaatcgttgaaattatgggacgccactgcggcgat
ttaaccattagtgcggcgcttgccagcggttgcgaatatattatcgtgccggaaaaaggt
ttggataaagagtcgctaatgcgtaatatcgaagacggttttaataaaggtaaacgtcat
gcgattattgcgattaccgaattaatgacggacgttcaggcattggcaaaagaaatcgaa
gaccgcttcggtcatgaaacgcgcgcaaccgtattaggtcacattcaacgcggcggtgca
ccttgcccgttcgaccgtattttagcttcccgtatgggcgtatatgcggtggatctgtta
ttacaaggtcacggcggtcgttgtatcggtatcaaaaatgagaatttggtacatcacgat
attattgatgcgattaacaatatgcgccgtccgttcaaagaagaactgtttgaggcggct
agaaaattattctaa

DBGET integrated database retrieval system