KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1290Help
Entry
APP7_1290         CDS       T00717                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APP7_1290
Enzymes [BR:apa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     APP7_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444348..1446366
Genome map
AA seq 672 aa AA seqDB search
MKSLHPYLNPYFFDEYGRRRYASQAVCHKIAKRLGSPKSKPIIPPVKVATEGQAVYIRLN
LANSNKALQARWQLHLENGEIRCGKVKRNAINLPKDLPLGYHHLQLKSEHYSLNCRLIIT
PKTAFQPKELQQKQKLWGAILQLYTLRSEHNWGIGDFSDLKTFLSRLAEKGGDFVGLNPI
HAIFPANPESASPYSPSSRLWQNIIYIDVAAIDAFQQSSEAQAWFHSAEVQQQLIEARAK
DYVDYSQVMGLKLEGLRLAYATFVQQDQQAFEQFINEYGESLKVQGTFDALHYWLSSQFS
EQWGWNFWAQEYQDYASNAVQTFQTEHSQLVRFYMWLQFVAQQQLRACNQLAKALNMPIG
FYRDLAVGVADNGAETWADKELFVLDASVGAPPDIMAPNGQNWGLSPMHPEVLQARGYQP
FIDLLRANMKDCGALRIDHILGFARMWWVAKGDSAKNGAYVRYPLEDLLAILALESQRNQ
CLIIAEALGTVPKGMLQKLEDKGILAYNIFYFEWDQHGSKPLANYPYQAMTTLSTHDLPT
LQGYWKGYDFDLGKKFGVYPSEKVLNILKQSRHFNKEAIRQAVEKVQDLAKDSEGVNLKF
VHQLQMYVADTNSALFGTQPEDWLNMLEPVNIPGTSNEYPNWRRKLSHTINEIFNHEQIN
QLLDAFEQKRNK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgcttcacccataccttaatccttatttctttgatgaatatggcagacgccgt
tatgccagccaagcggtctgtcacaaaattgcaaaacgcttaggttctcctaaaagcaaa
cctattattcctcctgtaaaggtagcaacagaaggacaagcggtctatattcgactaaat
cttgcaaatagcaataaagcattacaagctcgctggcaacttcacttagaaaacggtgaa
atacgttgcggtaaagtaaaacgtaatgcgatcaatttaccgaaagatctgcctctcggc
tatcatcatttacagcttaaaagtgagcattattcactgaactgccgcctgattattacg
ccgaaaactgctttccagccaaaagaattacaacaaaaacaaaaattatggggcgcaatt
ttacaactctatacgcttcgttccgaacataattggggcatcggcgattttagcgatttg
aaaaccttcttaagtcgacttgctgaaaaaggtggtgattttgttgggctaaatccaatt
catgcgattttcccagccaatccggaaagtgccagcccttatagcccctcatctcgttta
tggcaaaacattatttatatcgatgtagcagcgattgatgccttccaacaatctagcgaa
gcgcaagcctggtttcattccgcagaagttcaacaacagcttattgaggcaagagcaaaa
gactacgtagattattcgcaagtgatgggcttaaaactcgaaggattacgtttagcctat
gccactttcgttcagcaagatcaacaagctttcgaacaatttatcaatgaatacggcgaa
agcctaaaagtgcaaggtacattcgacgcactacattattggttatccagccaatttagc
gagcaatggggttggaatttctgggcgcaagaatatcaagactacgcatcaaatgcagta
cagacattccaaacggaacatagccaattagttcgtttctatatgtggttgcaatttgtg
gctcaacagcaattaagagcgtgtaatcaattggcaaaagcacttaatatgcctatcggc
ttttaccgtgatttagcggtaggcgttgccgataacggtgcggaaacttgggcggataaa
gagttatttgtgctagatgcctctgtcggtgcaccaccggatattatggcaccaaacgga
caaaactggggcttatcaccgatgcatccggaagtgctacaagctagaggatatcagcca
tttattgatttattgcgtgccaatatgaaagattgcggtgcattacgtatcgaccacatt
cttggttttgcacgtatgtggtgggtggcaaaaggcgattcggctaaaaacggcgcttat
gtacgttatccgctagaagatttattagcaattcttgcgttagaaagtcagcgaaatcag
tgtttaatcattgctgaagcacttggtacagtaccgaaaggtatgctacagaaattagaa
gacaaaggtattctcgcttataacattttctattttgaatgggatcaacacggcagtaag
ccattagctaattatccatatcaagcgatgacgacactcagtacgcatgatttaccaacc
ctacaaggctactggaaaggctacgactttgatttaggcaagaaatttggtgtttaccca
agtgagaaagtgcttaatattctgaaacaaagtcgccatttcaataaagaagcgattaga
caagcggtcgaaaaagtccaagatcttgcaaaagatagcgaaggcgtaaacttaaaattt
gtacatcaattacaaatgtatgtagcggataccaattctgctttatttggcactcagccg
gaagattggctaaatatgctcgagccggtaaatattcccggaacaagtaatgaatatccg
aattggcgtagaaaattaagccatacaattaatgagattttcaaccacgagcaaatcaat
caactacttgatgctttcgaacaaaaacgaaataaataa

DBGET integrated database retrieval system