KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1363Help
Entry
APP7_1363         CDS       T00717                                 

Definition
CysQ-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    APP7_1363
Enzymes [BR:apa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     APP7_1363
Transfer RNA biogenesis [BR:apa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    APP7_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1521235..1522050)
Genome map
AA seq 271 aa AA seqDB search
MQPLNSTLLEAVKRIAIEAGEHLKRFYQCSVQVKIKADHTPVTEADLFISQFVTEKLRQL
TPDVPILSEENCNIALADRQTWQEYWIIDPLDGTQQFIDRTDQFSVVIGLVQDHRPVLGV
IHSPILAKTYFAMAGNGAFLQENGEIRPLVGHQGLLQDNRLKITMGASAQQAVLNSVDKS
YQAEIFQYGSSSLKAGLLAEGKADCYVRFGDTGEWDTAVAEVLLSEVGGKIFNLKFEPLT
YNRRSTFINPYFVMVADKHLAWEQIFRFNAQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccattaaattcaacgctgttggaagcggttaaacggattgcgatagaggcggga
gaacaccttaaacgtttttatcagtgttcggtacaggtcaaaatcaaagcggatcatacg
ccggttacggaggcggatctgtttatcagccaattcgtaacggaaaaacttcgtcaatta
acgccggacgtgccgattttatccgaagaaaattgcaatatcgcattagcggatcgacaa
acttggcaagaatattggatcattgatccgttagacgggacgcaacaatttattgatcgt
accgatcaattttctgtggtaatcggtttagtgcaagatcatcgcccggtgttaggtgtg
atccattctccgattttagcgaagacttattttgctatggcgggaaacggcgcatttttg
caagaaaacggcgaaattcgaccgcttgtcggacatcagggcttacttcaggataatcgc
ttgaagattacgatgggtgcatctgcgcagcaggcggtattaaattcggtagataaatct
tatcaagcggaaatcttccaatacggttcaagcagtttaaaagcgggtttacttgccgaa
ggtaaagcggattgttacgtacgtttcggcgataccggagaatgggatacggcggttgcc
gaagtattactttcggaagtaggcggcaaaatttttaatttgaagtttgagccgcttact
tataatcggcgttcaacttttatcaacccctatttcgtgatggtggcggataagcatttg
gcttgggaacaaatttttagatttaatgcgcaatag

DBGET integrated database retrieval system