KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1430Help
Entry
APP7_1430         CDS       T00717                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Brite
Enzymes [BR:apa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     APP7_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1598745..1600145
Genome map
AA seq 466 aa AA seqDB search
MKKYLLSAIAAAGIGYFSLVGYAYWFDKEQAPKLLASADLPESHKAVAGVMFENGCQYCH
SANAELPAYAKLPIADQVMAEDIEKGLKFFRLDHLIEGMKDPSKLSEADLAKLEQVIRND
EMPVAKYIHIHWGSRPDEAQKKIILDWITAQRQAHFLPKAEGADATRLVQPIPDQLPTDP
HKVALGEGLYFDGRLSDDGTIQCHTCHQLAQAGVDNLPVSEGINGLKGGINAPTVFNAAF
NKWQFWDGREKTLADQAGGPPVNPVEMGSKNWDEILARLSKDEEFMKRFHEIYPTLTQAN
VTDAIGEYEKTLITPNSAFDRFLKGEQNALTDVQKRGYEHFKNAKCDTCHTGTAMGGQSF
EYMGLYADYFKDRGTELTEADHGRYAVTKDPSDMHRFKVPTLRNVALTAPYMHDASAKDL
KEAVRIMGIYQSNKQFSETELNELVAFLESLTGEYKGKLLTNEKVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttactttcggcaattgccgccgccggcatcggctatttttcacttgtg
ggctacgcctattggtttgataaagagcaagcgccaaaattattagcgtccgcagactta
cccgaatcgcataaagcggtcgcaggagtcatgtttgaaaacggctgccaatattgccac
tcggctaatgcggaattaccggcttatgccaagttaccaatcgcagaccaagtgatggct
gaagatattgaaaaaggtcttaagttcttccgtcttgatcatctgattgaaggaatgaaa
gatccgagcaaactttcagaagccgatcttgctaaattagaacaagtaattcgcaatgac
gaaatgccggttgctaaatatattcatatccactggggttctcgtcctgacgaagctcag
aaaaaaattatcttagattggattaccgcacaacgccaagcacacttcttaccaaaagcg
gaaggtgcggacgctactcgcttggttcagccgattcctgatcaattaccgaccgatccg
cataaagtagctttaggtgaagggctttattttgacggacgtttatctgatgacggtacg
attcaatgccatacttgccaccaattagcgcaagccggggtcgataacttaccggtatcg
gaagggattaacggtttaaaaggcggtatcaacgcgcctacggtgtttaatgcggcattt
aataaatggcaattctgggacggtcgtgagaaaaccttagcggatcaagcgggcggccca
ccggtaaacccggttgaaatgggttcaaaaaactgggatgaaattctcgccagactaagc
aaggacgaagaatttatgaaacgtttccacgagatttacccgactcttacgcaagcgaac
gtcaccgatgcaatcggtgaatatgaaaaaacgcttattacgccgaacagtgcattcgac
cgcttcttaaaaggcgagcaaaatgcgctaaccgatgtacaaaaacgcggttacgagcat
ttcaaaaatgcgaaatgcgatacttgccataccggtacggcaatgggcggacaatcattt
gaatatatgggcttatatgccgattacttcaaagatcgcggtacggaattaaccgaagcg
gatcacggtcgttatgcggtaactaaggatccaagcgatatgcaccgtttcaaagtgccg
actttacgtaacgtggcgttaactgcaccatatatgcacgatgcaagtgcgaaagactta
aaagaagcggttcgtattatgggtatttaccaaagcaataaacaattctctgagacagag
cttaatgagctagttgctttcttagaatcactgaccggtgaatataaaggcaaattacta
actaatgaaaaagtgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system