KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1733Help
Entry
APP7_1733         CDS       T00717                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APP7_1733
Enzymes [BR:apa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     APP7_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1924247..1925158
Genome map
AA seq 303 aa AA seqDB search
MKKLCVLGSVNADHVIRVPYFPKAGETLKGGHYHIAYGGKGANQAVAAARVRNTSLVEVD
FIACIGADDIGRAMKQAFVQDGINPEHIVEVADQMTGIAMIQVADSGENSIVISAGANAN
LDESVVAQHQATIERADCLLVQLETPLQAVEKALKIAKANHTQVILNPAPAQPLSDEILA
NIDMITPNETETALLTGIQVVDEQTAQQAANVFHQKGIQTVLITLGAKGAFLSENGNGEI
IAGFKVTPVDTTAAGDTFNGALAIALLEGKSMRDAVMFAHKASSISVTRMGAQSSIPTRA
ELV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgtgtgttgggcagcgtaaatgcggatcacgttattcgagtgccttat
ttcccgaaagcgggcgaaacgctgaaaggcggtcattatcacattgcgtatggcggcaaa
ggggctaatcaggcagtagcggcggctcgtgtgcgaaatacatcgttagttgaggtggat
tttatcgcttgtatcggcgctgatgatattggacgagcgatgaaacaagcctttgtgcaa
gacggcattaatcccgaacacattgttgaagtagctgaccaaatgaccggcattgcgatg
attcaagtggcggattcaggcgagaatagcattgtaatttccgccggtgcaaatgcaaac
ttagatgaaagcgtggtggcacaacatcaagctacgattgaaagagcggattgcttactg
gttcagctggaaacgccgttacaagcggtcgaaaaagcgttaaaaattgctaaggcaaat
catactcaagtcattttaaatccggcaccggcacaaccgctctcggatgaaattttggcg
aatatcgatatgattaccccaaacgaaacggaaactgccttactgacaggcattcaagtg
gtcgatgaacaaaccgctcaacaagcagcgaatgtgttccatcaaaaagggattcaaacc
gtgttaattactttgggggcgaaaggggcgtttttaagtgaaaacggtaacggtgaaatc
attgccggctttaaagtcacaccggtggacaccaccgccgccggcgatacctttaacggc
gcattggcgattgctttattagaaggcaaatcaatgcgagatgcggtcatgtttgcccac
aaagcctcttcgatttcagtcactcgtatgggtgcacaaagttcgattccaactcgagcg
gaattagtttaa

DBGET integrated database retrieval system