KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1745Help
Entry
APP7_1745         CDS       T00717                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    APP7_1745
Enzymes [BR:apa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     APP7_1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1939975..1941741
Genome map
AA seq 588 aa AA seqDB search
MTTLKSTPVKIGIRPTIDGRRMGVRESLEEQTMNMAKAVAELLQSEIRHPNGDFVECVIA
DTTIGGVAEAAACAEKFKLENVGAVITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGA
VYLAAALAGHSQLGLPAFSIYGTEVQEANDQSIPADVREKLLRFARAGLAVANIRGKSYL
SIGSVSMGIAGSIVNQPFFQEYLGMRNEYVDMTEIKRRLDRKIYDEEEFKLAMSWVEQYC
KDGIDVNAPQNQRSPEERSKLWEDVVKMTIIGRDLMVGNPRLAELGYVEESMGHNAVAAG
FQGQRQWTDHLPNGDFMEAILNSTYDWNGVRAPHILATENDSLNGVGMLLANQLTGQAQI
FADVRTYWSEDSVERVTGWRPESGFLHLLNSGSAALDGTGQHTDKDGNPVVKPAWEVTEE
DGKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGMPFTMHRINIIKGLGPVLQIAEGWSVE
LPQHVHETLSKRTDQTWPCTWFVPRLTGKGAFTDVYSVMANWGANHCVATYGHVGADLIT
LASMLRIPVCMHNVEDKDVFRPSAWNGFGQDKEGQDYRACANFGPLYK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccttgaaatcaactccagtaaaaattggtatccgccctacaattgacggtcgc
cgcatgggggttcgtgagtctttagaagaacaaacaatgaatatggcaaaagcggttgcc
gaattattgcaatcggaaattcgccacccaaacggcgattttgtcgaatgcgtgattgcc
gacaccactatcggcggcgtagcggaagcggcggcttgtgccgaaaaatttaaacttgaa
aatgtcggtgcggtgattaccgttaccccttgctggtgttacggttctgaaaccatcgat
atggatccgcatatgccgaaagcgatttggggctttaacggtaccgaacgcccgggagcg
gtgtatttagcggctgcattagcaggacacagccaattaggtttaccggctttctcaatc
tacggtacggaagttcaagaagcgaatgatcaatctattcctgccgacgtacgtgaaaaa
ttattacgtttcgctcgtgccggtttagcggttgcgaatatccgcggtaaatcttattta
tctatcggttccgtttcaatggggattgccggttctatcgtaaatcaaccgttcttccaa
gaatacctcggtatgcgtaacgaatacgttgatatgaccgaaattaaacgccgtttagat
cgcaaaatttatgatgaagaagaatttaaacttgcgatgagctgggtagaacaatattgc
aaagacggtattgatgtaaatgctccgcaaaaccaacgcagtccggaagaacgatccaaa
ctttgggaagacgtggtgaaaatgaccattatcggacgtgatttaatggtgggaaatcct
cgtttagccgaactcggttatgtagaagaatcaatgggtcataatgcggttgccgccggt
ttccaaggacaacgtcaatggaccgaccatttaccgaacggcgactttatggaagcgatt
ctaaattcaacctatgactggaacggtgtgcgtgcgccgcatattttagctactgaaaac
gactcgttgaacggtgtcggtatgttgttggcaaaccaattaaccggtcaagcgcaaatc
tttgcggacgtgcgtacttattggagtgaagattcggttgaacgcgttaccggctggcgt
ccggaaagcggtttcttacacctattaaattccggttctgcggcgttagacggtaccggt
cagcatacggataaagacggtaatccggtcgttaaaccggcttgggaagtgaccgaagaa
gacggtaaacgttgcttagaaaatacacgttggtgtccggctgtacacgaatacttccgt
ggcggcggtttatcttctcaattcttaaccaaaggcggtatgccgttcacgatgcaccgt
atcaatattattaaaggccttggtcctgtattacaaatcgcagaaggttggtcggtcgaa
ttacctcaacacgtacatgaaaccttaagcaaacgtaccgaccaaacatggccttgtact
tggtttgtaccgcgtttaaccggtaaaggtgcgtttaccgatgtatatagcgtgatggcg
aactggggggcaaaccactgtgtagcgacttacggtcacgtgggtgcggacttaattact
ttagcttcaatgttacgtattccggtatgtatgcataacgtagaagataaagatgtgttc
cgtccaagtgcatggaacggtttcggtcaagataaagaaggtcaagattaccgtgcatgt
gcaaacttcggtccattatataaataa

DBGET integrated database retrieval system