KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_1748Help
Entry
APP7_1748         CDS       T00717                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    APP7_1748
Enzymes [BR:apa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     APP7_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1943871..1944521
Genome map
AA seq 216 aa AA seqDB search
MNRRELARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGTPYEQMTEDSIVYVDK
DGKHEEGKLPSSEWQFHLAVYEARPELNAVVHNHALNCAAASILGEDIPAIHYMIACTGN
DHIPCVPYATFGTHKLADYVREGIKQSKAILLAHHGLITADKTLDKALGIAHEVEVIAEW
YLKLLATGRPLPTLSKEEMQTVLEKFKSYGSWVEEK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcagagaactggctcgacaaattatcgatacttgccttgaaatgacacgtctc
ggtttaaaccaagggacggcaggtaatgttagcgtacgttatcaagacggtatgctgatt
accccgaccggtacgccgtacgaacaaatgaccgaagacagtatcgtttatgtggataaa
gacggtaaacacgaagaaggaaagctcccgtcaagcgaatggcaattccatttagcagta
tatgaagcgcgtccggaattaaatgcggtggtgcataaccacgcattgaattgcgccgcc
gcttctatcctcggcgaagatattccggctatccactatatgatcgcttgtaccggtaac
gatcatattccatgcgtaccttatgccactttcggcacacacaaattagctgattacgtg
cgtgagggaatcaaacaaagtaaagcgattttactggcgcatcacggcttaattaccgca
gataaaaccttggataaagcgttaggtatcgctcatgaggttgaagtgattgccgagtgg
tatttaaaactgcttgcaacaggcagaccgcttccgacgttatccaaagaagagatgcaa
accgtattggaaaaattcaaatcttacggttcttgggtcgaagaaaaataa

DBGET integrated database retrieval system