KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_2008Help
Entry
APP7_2008         CDS       T00717                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_2008
Enzymes [BR:apa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     APP7_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2213887..2214696
Genome map
AA seq 269 aa AA seqDB search
MKTEFIRQISQGISLEKCHELYVIRVAHKLGTAVVALQGAQLLSWQPATAKQDVLWLSEI
EPFQKGNAIRGGVPICYPWFGSVKSPSHGTARIREWSLSHYETDAEYAYLEFSLYDEQNI
IEAKIEMAFSQECHLIFTHYAEQEAQAALHSYFNVSNIEQTEVKGLPHECFDSLTKQFVQ
VPSPRKINENVDCIYSAEQAINRIEDMANQRTIQIEHIDASDVVLWNPWHKATSAMSETG
YQTMVCVETARINRKLQQGDSFEVIFKLV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgaatttattcgtcaaatcagccaaggtatcagcctcgagaaatgtcatgag
ttatatgtgattcgtgttgcacataagttaggaacagcagtagtggctttacaaggcgca
caattattaagttggcaaccggctacggcgaaacaagacgtattatggctttcggagatt
gagccgttccaaaaaggcaatgcgattcgcggcggtgtgccgatttgttatccgtggttc
ggttcggtaaaaagtccgtcacacggcacggctcgcattcgtgaatggtcgctcagtcat
tatgaaacggatgcggaatatgcttacttagaattttcgctctatgacgaacaaaatatt
atcgaagcgaaaattgaaatggcgtttagccaagaatgtcatttgattttcactcactat
gccgaacaagaagcgcaggcggcattgcatagctatttcaatgtatcgaatattgagcaa
accgaagtgaaaggcttaccgcacgaatgctttgattcattaaccaaacaatttgtacaa
gtgccttcgccgcgtaaaattaacgaaaatgtcgattgtatttatagtgcggagcaggct
attaatcgcattgaagatatggcgaatcaacgcacgattcaaattgaacacattgatgcg
agcgacgtcgtgttatggaatccgtggcataaagcgacaagtgcgatgagcgaaaccggt
tatcaaacgatggtatgcgtcgaaaccgcccgtatcaatcgaaaattacagcaaggcgat
agttttgaagtgatctttaaattagtttag

DBGET integrated database retrieval system