KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_2014Help
Entry
APP7_2014         CDS       T00717                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APP7_2014
   01230 Biosynthesis of amino acids
    APP7_2014
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_2014
   00051 Fructose and mannose metabolism
    APP7_2014
   00562 Inositol phosphate metabolism
    APP7_2014
Enzymes [BR:apa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APP7_2014
Exosome [BR:apa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APP7_2014
  Exosomal proteins of bladder cancer cells
   APP7_2014
  Exosomal proteins of melanoma cells
   APP7_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2223446..2224216)
Genome map
AA seq 256 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIAGLKAELADVKGCDVAIAPPVMYLAEAEAALAGQSV
IALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKECDTFIAKKFAALKA
AGLVPVLCIGETEAENEAGQTEAVCAKQIDAVIDALGVEAFNGAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRGHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLK
APAFAVIVKAAEKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccacttgtaatgggtaactggaaattaaacggtagcaaagcatttaca
aaagagttaatcgccggcttaaaagcggaattagcggatgttaaaggctgtgacgttgca
atcgcgccgccggtaatgtacttagcggaagcggaagctgcattagcgggtcaatcagtc
atcgcattaggcgcacaaaacgtagacgtaaacgtacaaggtgcatttaccggtgatatt
tcaaccgaaatgttaaaagacttcggtgcaaaatatattattatcggtcactccgagcgt
cgtacttatcacaaagaatgcgatacgttcattgcgaaaaaattcgctgcgttaaaagcg
gcgggtttagtaccggtattatgtatcggtgaaaccgaagcggaaaacgaagcgggtcaa
accgaagcggtatgcgcaaaacaaattgatgcggtaatcgatgcgttaggcgttgaagcg
tttaacggtgcggtaatcgcctacgaaccgatttgggctatcggtaccggtaaatccgca
acacctgcgcaagcgcaagcggttcacgcattcatccgcggtcacattgcagcgaaatca
caagcggttgcggatcaagtgattatccaatacggcggttcggtaaacgatgcgaatgcg
gcggaattattcactcagccggatatcgacggtgcgttagtcggcggtgcgtcattaaaa
gcgcctgcatttgcggttatcgtcaaagcggcggaaaaagcgaaagcgtaa

DBGET integrated database retrieval system