KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_2047Help
Entry
APP7_2047         CDS       T00717                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    APP7_2047
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_2047
  Lipid metabolism
   00071 Fatty acid degradation
    APP7_2047
  Amino acid metabolism
   00350 Tyrosine metabolism
    APP7_2047
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APP7_2047
   00626 Naphthalene degradation
    APP7_2047
Enzymes [BR:apa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APP7_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2251158..2252207
Genome map
AA seq 349 aa AA seqDB search
MMKMRAAVVAPQCDGTVEIVERDIPEIKNGEALVEVEYCGVCHTDLHVAAGDYGKKPGRI
LGHEGIGIVKSIAPDVTNLKVGDRVSIAWMFESCGSCEYCTTGRETLCRSVKNAGYTVDG
GMATHCVVTADYAVKVPDGLDPAQASSITCAGVTTYKGIKVSGVRAGQWIAIYGAGGLGN
LAVQYAKKVFGARVIAIDINDDKLAFAKEVGADLTINPLKEDSVQVIQEKVGGAHAAVVT
AVSKVAFNAAVNCVRAGGRVVAIGLPPETMDLSIPRIVLDGIEIVGSLVGTRQDLAEAFQ
FGAEGLVVPLVQLRRLDEANDIFQEMRDGKIQGRMVIDMKKGCGCGCSH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgcgtgctgctgtggttgccccacaatgtgatggaacagttgaaattgtt
gaacgtgacattccggaaatcaaaaatggcgaagcccttgttgaagttgaatattgcggc
gtatgtcataccgatttacacgtcgctgccggcgattacggtaaaaaaccgggtcgtatc
ttaggccacgaagggatcggtatcgttaaatcgatcgcaccggatgtgactaatttaaaa
gtcggtgatcgtgtcagtattgcatggatgttcgagagctgcggctcgtgcgaatattgc
actaccggacgtgaaacgctttgccgtagcgtgaaaaatgccggctatacggtggacggc
ggtatggcgacgcactgtgtcgtaacggcagattatgcggtaaaagtaccggacggtttg
gatccggcacaagcaagtagtatcacttgcgccggtgtaaccacttataaagggattaaa
gtctcgggcgtacgtgcgggacaatggattgcgatttacggtgccggcggtttaggcaac
ttggcggtgcaatatgcgaagaaagtattcggcgcacgtgtgattgcaatcgatattaat
gatgacaaactggcgtttgccaaagaagtcggtgcggatttaaccattaacccgttgaaa
gaagacagcgtacaagtgattcaagaaaaagtcggcggtgcgcatgcggcggttgtgacg
gcagtatctaaagtggcgtttaacgctgcggtgaactgcgttcgagcaggcggtcgcgtg
gtggctatcggtctgccgccggaaaccatggatctctctatccctcgtatcgtattggac
ggtatcgaaattgtcggctcgttggtcggtactcgtcaagatcttgccgaggcgttccaa
ttcggtgcggaaggtttagtagtaccgttagtgcaattacgtcgcttggacgaagcgaat
gacattttccaagaaatgcgtgacggtaaaattcaaggtcgaatggtgatcgatatgaaa
aaaggctgcggttgcggttgtagtcactaa

DBGET integrated database retrieval system