KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_2047Help
Entry
APP7_2047         CDS       T00717                                 

Gene name
adhI
Definition
(GenBank) Alcohol dehydrogenase 1
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
apa00010  Glycolysis / Gluconeogenesis
apa00071  Fatty acid degradation
apa00350  Tyrosine metabolism
apa00625  Chloroalkane and chloroalkene degradation
apa00626  Naphthalene degradation
apa01100  Metabolic pathways
apa01110  Biosynthesis of secondary metabolites
apa01120  Microbial metabolism in diverse environments
apa01130  Biosynthesis of antibiotics
apa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APP7_2047 (adhI)
  Lipid metabolism
   00071 Fatty acid degradation
    APP7_2047 (adhI)
  Amino acid metabolism
   00350 Tyrosine metabolism
    APP7_2047 (adhI)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APP7_2047 (adhI)
   00626 Naphthalene degradation
    APP7_2047 (adhI)
Enzymes [BR:apa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APP7_2047 (adhI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding ADH_N_2 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACE62699
UniProt: B3H329
Position
2251158..2252207
Genome map
AA seq 349 aa AA seqDB search
MMKMRAAVVAPQCDGTVEIVERDIPEIKNGEALVEVEYCGVCHTDLHVAAGDYGKKPGRI
LGHEGIGIVKSIAPDVTNLKVGDRVSIAWMFESCGSCEYCTTGRETLCRSVKNAGYTVDG
GMATHCVVTADYAVKVPDGLDPAQASSITCAGVTTYKGIKVSGVRAGQWIAIYGAGGLGN
LAVQYAKKVFGARVIAIDINDDKLAFAKEVGADLTINPLKEDSVQVIQEKVGGAHAAVVT
AVSKVAFNAAVNCVRAGGRVVAIGLPPETMDLSIPRIVLDGIEIVGSLVGTRQDLAEAFQ
FGAEGLVVPLVQLRRLDEANDIFQEMRDGKIQGRMVIDMKKGCGCGCSH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgcgtgctgctgtggttgccccacaatgtgatggaacagttgaaattgtt
gaacgtgacattccggaaatcaaaaatggcgaagcccttgttgaagttgaatattgcggc
gtatgtcataccgatttacacgtcgctgccggcgattacggtaaaaaaccgggtcgtatc
ttaggccacgaagggatcggtatcgttaaatcgatcgcaccggatgtgactaatttaaaa
gtcggtgatcgtgtcagtattgcatggatgttcgagagctgcggctcgtgcgaatattgc
actaccggacgtgaaacgctttgccgtagcgtgaaaaatgccggctatacggtggacggc
ggtatggcgacgcactgtgtcgtaacggcagattatgcggtaaaagtaccggacggtttg
gatccggcacaagcaagtagtatcacttgcgccggtgtaaccacttataaagggattaaa
gtctcgggcgtacgtgcgggacaatggattgcgatttacggtgccggcggtttaggcaac
ttggcggtgcaatatgcgaagaaagtattcggcgcacgtgtgattgcaatcgatattaat
gatgacaaactggcgtttgccaaagaagtcggtgcggatttaaccattaacccgttgaaa
gaagacagcgtacaagtgattcaagaaaaagtcggcggtgcgcatgcggcggttgtgacg
gcagtatctaaagtggcgtttaacgctgcggtgaactgcgttcgagcaggcggtcgcgtg
gtggctatcggtctgccgccggaaaccatggatctctctatccctcgtatcgtattggac
ggtatcgaaattgtcggctcgttggtcggtactcgtcaagatcttgccgaggcgttccaa
ttcggtgcggaaggtttagtagtaccgttagtgcaattacgtcgcttggacgaagcgaat
gacattttccaagaaatgcgtgacggtaaaattcaaggtcgaatggtgatcgatatgaaa
aaaggctgcggttgcggttgtagtcactaa

DBGET integrated database retrieval system