KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_B0003Help
Entry
APP7_B0003        CDS       T00717                                 

Gene name
folP
Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:apa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
ABB7_B:1678..2634
Genome map
AA seq 318 aa AA seqDB search
MKHKNRELVLFFAITFYYSLFFYFKCSTDPIIEAPMNKSLIIFGIVNITSDSFSDGGRYL
APDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLD
SYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGD
IMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLP
VLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALK
ETARIRYQKTEGTSIESN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcataagaatagagagttagtattattttttgcgattacattttactactctcta
tttttttatttcaaatgttcaacagaccctattatagaagcccccatgaataaatcgctc
atcattttcggcatcgtcaacataacctcggacagtttctccgatggaggccggtatctg
gcgccagacgcagccattgcgcaggcgcgtaagctgatggccgagggggcagatgtgatc
gacctcggtccggcatccagcaatcccgacgccgcgcctgtttcgtccgacacagaaatc
gcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcattcccgtctcgctcgac
agttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtggcctatctcaatgat
attcgcggttttccagacgctgcgttctatccgcaattggcgaaatcatctgccaaactc
gtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgaggcacccgctggcgac
atcatggatcacattgcggcgttctttgacgcgcgcatcgcggcgctgacgggtgccggt
atcaaacgcaaccgccttgtccttgatcccggcatggggttttttctgggggctgctccc
gaaacctcgctctcggtgctggcgcggttcgatgaattgcggctgcgcttcgatttgccg
gtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcacaggccgtggtccgggg
gatgtcggggccgcgacactcgctgcagagcttgccgccgccgcaggtggagctgacttc
atccgcacacacgagccgcgccccttgcgcgacgggctggcggtattggcggcgctgaaa
gaaaccgcaagaattcgttatcagaaaactgaaggaacctccattgaatcgaactaa

DBGET integrated database retrieval system