KEGG   Actinobacillus pleuropneumoniae AP76 (serotype 7): APP7_B0003Help
Entry
APP7_B0003        CDS       T00717                                 

Gene name
folP
Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K18824  
dihydropteroate synthase type 1/2 [EC:2.5.1.15]
Organism
apa  Actinobacillus pleuropneumoniae AP76 (serotype 7)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:apa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APP7_B0003 (folP)
Enzymes [BR:apa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     APP7_B0003 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
ABB7_B:1678..2634
Genome map
AA seq 318 aa AA seqDB search
MKHKNRELVLFFAITFYYSLFFYFKCSTDPIIEAPMNKSLIIFGIVNITSDSFSDGGRYL
APDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLD
SYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGD
IMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLP
VLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALK
ETARIRYQKTEGTSIESN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcataagaatagagagttagtattattttttgcgattacattttactactctcta
tttttttatttcaaatgttcaacagaccctattatagaagcccccatgaataaatcgctc
atcattttcggcatcgtcaacataacctcggacagtttctccgatggaggccggtatctg
gcgccagacgcagccattgcgcaggcgcgtaagctgatggccgagggggcagatgtgatc
gacctcggtccggcatccagcaatcccgacgccgcgcctgtttcgtccgacacagaaatc
gcgcgtatcgcgccggtgctggacgcgctcaaggcagatggcattcccgtctcgctcgac
agttatcaacccgcgacgcaagcctatgccttgtcgcgtggtgtggcctatctcaatgat
attcgcggttttccagacgctgcgttctatccgcaattggcgaaatcatctgccaaactc
gtcgttatgcattcggtgcaagacgggcaggcagatcggcgcgaggcacccgctggcgac
atcatggatcacattgcggcgttctttgacgcgcgcatcgcggcgctgacgggtgccggt
atcaaacgcaaccgccttgtccttgatcccggcatggggttttttctgggggctgctccc
gaaacctcgctctcggtgctggcgcggttcgatgaattgcggctgcgcttcgatttgccg
gtgcttctgtctgtttcgcgcaaatcctttctgcgcgcgctcacaggccgtggtccgggg
gatgtcggggccgcgacactcgctgcagagcttgccgccgccgcaggtggagctgacttc
atccgcacacacgagccgcgccccttgcgcgacgggctggcggtattggcggcgctgaaa
gaaaccgcaagaattcgttatcagaaaactgaaggaacctccattgaatcgaactaa

DBGET integrated database retrieval system