KEGG   Candidatus Puniceispirillum marinum: SAR116_0022Help
Entry
SAR116_0022       CDS       T01207                                 

Definition
(GenBank) hydrolase, alpha/beta fold family
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAR116_0022
Enzymes [BR:apb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SAR116_0022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Thioesterase LIDHydrolase Abhydrolase_3 Esterase Ser_hydrolase DUF1100 PGAP1 Peptidase_S9 Abhydrolase_2 DUF3089 BAAT_C DUF2974 UPF0227 LCAT DUF900 Chlorophyllase2
Motif
Other DBs
NCBI-ProteinID: ADE38264
UniProt: D5BNJ7
Position
21165..22133
Genome map
AA seq 322 aa AA seqDB search
MYRHASEAGLVLPSGTDINQPYDGHNLRGHLAEIADQSTMQGKVRGHVLLCPGFTEFCEK
YSDVIKAFNDRGYNVLAIDWPGQGMSGHLGRHRMAVHCDSFDQHIGAMDRLITAVGWQDR
PVILFGHSMGGHLALRLCQHLRAQVQAAIILSPMIVPPVMPVWMVRLITQTLVAAGFGRF
YLPFKKPPTLDYIRQFRPHNLLSRDKAGYESQFVWFDDNPELRRSQPTAGWVRAAYESCA
RTTLNKDWMAAVDCPVLGFEAGDERVVHKKSSDRMLACLPHLTRYEYDGARHELLNETPD
VVADIWTRIDAFLGGRGQSRLK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccatgccagcgaagcggggcttgtcttgccgtctggtaccgatatcaaccag
ccctatgatggccataatctgcgcgggcatctggccgaaatagctgatcaaagcacaatg
caggggaaagtgcgggggcatgttctgctgtgtccgggatttaccgaattttgcgaaaaa
tatagcgatgtgataaaggcgttcaatgaccgcggttataatgtgctggcgatagactgg
cccgggcagggcatgtcggggcatctggggcggcatcgtatggcggtgcattgtgacagc
tttgaccagcatattggcgcgatggacagattgatcacggcggtgggctggcaggatagg
ccagtgatactgttcggtcattcgatgggcgggcatctggcgttgcgcctgtgccagcat
ctgcgggcgcaggtgcaggcggcgattatcctgtcgccgatgatcgtgccacccgtcatg
cctgtatggatggtgcgtctcatcacgcagacgcttgttgcggcagggttcgggcgtttc
tatctgccgtttaaaaagccgccgacgcttgattatatcaggcaatttcgcccgcataat
ctgctgtcacgcgataaagccggatatgaaagccaatttgtctggtttgatgataatccc
gaattgcgacggagtcagccaaccgcaggctgggtgcgcgccgcctatgaatcatgtgcg
cgcacgacattgaacaaagactggatggcggcggtagattgtccggtgctgggctttgag
gcgggtgatgaacgggtggtgcataaaaagtctagtgaccggatgctggcctgtctgccg
catctgacgcgctatgaatatgacggggcgcggcatgaattgctgaatgaaacacccgat
gtggtggcggatatatggacgcggatcgatgcgtttttaggcggccgaggtcaaagccgt
ttgaaatag

DBGET integrated database retrieval system