KEGG   Candidatus Puniceispirillum marinum: SAR116_0022Help
Entry
SAR116_0022       CDS       T01207                                 

Definition
alpha/beta fold family hydrolase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:apb00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21165..22133
Genome map
AA seq 322 aa AA seqDB search
MYRHASEAGLVLPSGTDINQPYDGHNLRGHLAEIADQSTMQGKVRGHVLLCPGFTEFCEK
YSDVIKAFNDRGYNVLAIDWPGQGMSGHLGRHRMAVHCDSFDQHIGAMDRLITAVGWQDR
PVILFGHSMGGHLALRLCQHLRAQVQAAIILSPMIVPPVMPVWMVRLITQTLVAAGFGRF
YLPFKKPPTLDYIRQFRPHNLLSRDKAGYESQFVWFDDNPELRRSQPTAGWVRAAYESCA
RTTLNKDWMAAVDCPVLGFEAGDERVVHKKSSDRMLACLPHLTRYEYDGARHELLNETPD
VVADIWTRIDAFLGGRGQSRLK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccatgccagcgaagcggggcttgtcttgccgtctggtaccgatatcaaccag
ccctatgatggccataatctgcgcgggcatctggccgaaatagctgatcaaagcacaatg
caggggaaagtgcgggggcatgttctgctgtgtccgggatttaccgaattttgcgaaaaa
tatagcgatgtgataaaggcgttcaatgaccgcggttataatgtgctggcgatagactgg
cccgggcagggcatgtcggggcatctggggcggcatcgtatggcggtgcattgtgacagc
tttgaccagcatattggcgcgatggacagattgatcacggcggtgggctggcaggatagg
ccagtgatactgttcggtcattcgatgggcgggcatctggcgttgcgcctgtgccagcat
ctgcgggcgcaggtgcaggcggcgattatcctgtcgccgatgatcgtgccacccgtcatg
cctgtatggatggtgcgtctcatcacgcagacgcttgttgcggcagggttcgggcgtttc
tatctgccgtttaaaaagccgccgacgcttgattatatcaggcaatttcgcccgcataat
ctgctgtcacgcgataaagccggatatgaaagccaatttgtctggtttgatgataatccc
gaattgcgacggagtcagccaaccgcaggctgggtgcgcgccgcctatgaatcatgtgcg
cgcacgacattgaacaaagactggatggcggcggtagattgtccggtgctgggctttgag
gcgggtgatgaacgggtggtgcataaaaagtctagtgaccggatgctggcctgtctgccg
catctgacgcgctatgaatatgacggggcgcggcatgaattgctgaatgaaacacccgat
gtggtggcggatatatggacgcggatcgatgcgtttttaggcggccgaggtcaaagccgt
ttgaaatag

DBGET integrated database retrieval system