KEGG   Candidatus Puniceispirillum marinum: SAR116_0160Help
Entry
SAR116_0160       CDS       T01207                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase (EC:5.3.1.26)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_0160
   01230 Biosynthesis of amino acids
    SAR116_0160
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAR116_0160
   00051 Fructose and mannose metabolism
    SAR116_0160
Enzymes [BR:apb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SAR116_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
168172..168621
Genome map
AA seq 149 aa AA seqDB search
MAAHAKIYLASDHAGVELRKAVAAHIVAQGLQVVDLGPDDGSSVDYPDYGEKLAMALSDD
ADARGVAICGSGIGISIAVNRFPWARAALVTSAEAARLSREHNNANVIALGERLISQETA
LACIDAFLATDFEGGRHARRVDKLTKLSP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcatgcaaaaatttatctggcatctgatcatgccggtgttgaactgcgcaaa
gcggtcgctgcgcatattgtggcgcaaggtttacaggtggttgatcttggcccagatgat
ggcagttcagttgactatccagattatggagaaaagctagctatggcattatctgacgat
gctgatgcacgtggcgttgctatttgtggaagtggtataggtatttcaatcgctgtaaat
cgttttccatgggcgcgtgccgcattggtcacgtctgccgaagcggcacgtctgtcacgt
gagcataataatgcaaatgtgattgcgcttggtgaacggctgataagccaggaaacggcg
ctggcgtgcattgatgcgtttctcgctaccgactttgagggtggtcgtcatgcgaggcgg
gtggataagttgacgaaactttcgccctag

DBGET integrated database retrieval system