KEGG   Candidatus Puniceispirillum marinum: SAR116_0198Help
Entry
SAR116_0198       CDS       T01207                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR116_0198
   01230 Biosynthesis of amino acids
    SAR116_0198
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR116_0198
   00051 Fructose and mannose metabolism
    SAR116_0198
   00562 Inositol phosphate metabolism
    SAR116_0198
Enzymes [BR:apb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAR116_0198
Exosome [BR:apb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAR116_0198
  Exosomal proteins of bladder cancer cells
   SAR116_0198
  Exosomal proteins of melanoma cells
   SAR116_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210649..211392
Genome map
AA seq 247 aa AA seqDB search
MIIAANWKMNPDLETAGMLASRLAGISFGNVKRVLFAPHPYIIPMSIRLAQSDITLGGQD
CHTAESGAHTGDVSALMLRDSGATMVLVGHSERRSDHGEDDALIMAKANAALAHNLDVMI
CVGETRNDREAGNAESVVLAQLQGSIPKAMDPARLIVAYEPVWAIGTGLVPSSEDIAAMH
ENISSWLSSAFPNRGDTHIPVLYGGSVKPGNAAEILSLPAVDGALVGGASLDADGFEAIC
AAASNVA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgattatagcagcaaattggaaaatgaatcctgaccttgaaacggctggtatgttagct
agccgccttgcgggtatttcctttggcaatgtaaagcgtgttttgtttgcaccgcatccc
tatatcatccccatgtcaataaggctggcgcaaagtgacataacgctgggtggacaggat
tgccacaccgccgagtctggtgcccatacgggtgatgtttcggcactcatgctgcgcgac
agtggtgctacaatggttcttgtcgggcattctgaacggcgtagcgatcatggtgaagat
gatgcacttatcatggccaaggccaatgcagcgcttgcgcataatctggatgtcatgatc
tgtgttggcgaaacccgcaatgatcgggaagctggtaatgccgaatccgttgtgcttgcg
caattacaaggctcgattcccaaggctatggatccggctaggttgattgtcgcttatgaa
cccgtatgggcgattggcaccggcctggtgccatcatcagaagatattgcggcaatgcat
gaaaacattagcagttggctttcctcggcatttccgaacaggggtgatactcatattccg
gtactttatggcggttcggtaaagcccggcaacgctgctgaaattctatcattgccagcg
gttgacggggcattggttggcggtgctagcctagatgctgatggatttgaggccatttgc
gcggccgcatctaatgttgcatag

DBGET integrated database retrieval system