KEGG   Candidatus Puniceispirillum marinum: SAR116_0198Help
Entry
SAR116_0198       CDS       T01207                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00010  Glycolysis / Gluconeogenesis
apb00051  Fructose and mannose metabolism
apb00562  Inositol phosphate metabolism
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
apb01200  Carbon metabolism
apb01230  Biosynthesis of amino acids
Module
apb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR116_0198
   00051 Fructose and mannose metabolism
    SAR116_0198
   00562 Inositol phosphate metabolism
    SAR116_0198
Enzymes [BR:apb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAR116_0198
Exosome [BR:apb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAR116_0198
  Exosomal proteins of bladder cancer cells
   SAR116_0198
  Exosomal proteins of melanoma cells
   SAR116_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF5434
Motif
Other DBs
NCBI-ProteinID: ADE38441
UniProt: D5BPF9
Position
210649..211392
Genome map
AA seq 247 aa AA seqDB search
MIIAANWKMNPDLETAGMLASRLAGISFGNVKRVLFAPHPYIIPMSIRLAQSDITLGGQD
CHTAESGAHTGDVSALMLRDSGATMVLVGHSERRSDHGEDDALIMAKANAALAHNLDVMI
CVGETRNDREAGNAESVVLAQLQGSIPKAMDPARLIVAYEPVWAIGTGLVPSSEDIAAMH
ENISSWLSSAFPNRGDTHIPVLYGGSVKPGNAAEILSLPAVDGALVGGASLDADGFEAIC
AAASNVA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgattatagcagcaaattggaaaatgaatcctgaccttgaaacggctggtatgttagct
agccgccttgcgggtatttcctttggcaatgtaaagcgtgttttgtttgcaccgcatccc
tatatcatccccatgtcaataaggctggcgcaaagtgacataacgctgggtggacaggat
tgccacaccgccgagtctggtgcccatacgggtgatgtttcggcactcatgctgcgcgac
agtggtgctacaatggttcttgtcgggcattctgaacggcgtagcgatcatggtgaagat
gatgcacttatcatggccaaggccaatgcagcgcttgcgcataatctggatgtcatgatc
tgtgttggcgaaacccgcaatgatcgggaagctggtaatgccgaatccgttgtgcttgcg
caattacaaggctcgattcccaaggctatggatccggctaggttgattgtcgcttatgaa
cccgtatgggcgattggcaccggcctggtgccatcatcagaagatattgcggcaatgcat
gaaaacattagcagttggctttcctcggcatttccgaacaggggtgatactcatattccg
gtactttatggcggttcggtaaagcccggcaacgctgctgaaattctatcattgccagcg
gttgacggggcattggttggcggtgctagcctagatgctgatggatttgaggccatttgc
gcggccgcatctaatgttgcatag

DBGET integrated database retrieval system