KEGG   Candidatus Puniceispirillum marinum: SAR116_0251Help
Entry
SAR116_0251       CDS       T01207                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
apb  Candidatus Puniceispirillum marinum
Brite
Enzymes [BR:apb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SAR116_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267156..268922
Genome map
AA seq 588 aa AA seqDB search
MRFFNLFDSHFFNNFLLRYCRIGIAADRRKHIPQISTGKVRGRHAAANFIIPANTRLSAR
MSFHRRAQIPVKSADIILLDTQPHRIHNANQFFGIGIARPRRRPQRFTCLDKSSFFHKVA
CCFDFSMGKDRQENSNDHKHQKATHFKSFVFTLIASMVFGHATFAETTDLPRPLVDADFH
NIDAMQASLGQKLFYDKILSGNQNISCGTCHHHRFGGSDGLSLGIGEGGVGVGPTRLPGF
GDNRIKKRVPRNASALWNIGAKEVRVLFQDGRLSVSDDYENGFNSPAEEWLPNGLDTILA
AQAILPMTAQFEMAGNPKENEVAGAAHDRIDAVWPIIAKRVRIIPEYGQLFVDAFDDVET
ADQVDITHIAKALGAFIGQEWRSHDSPFDAFISGDKTALNASQKRGLDLFYGKANCASCH
SGSLLSDHKFYALALPPFGPGRTRRFDPYVRDVGRMGESDDLADAYRFKTPQLRNVALTG
PYGHNGAYASLENMVRHHLNPLQMLDEWQPEMAQLPTAEWLQAIDFVVMSDKREMARQRS
HLDITPIDLNDREIDDLVAFLHSLTGATALRLPLGVPDTVPSGLPVDK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttttcaatttgttcgacagtcatttttttaacaacttcctcctgcgatattgc
cgcatcgggatcgccgccgatcgccgaaagcacataccacagataagcacgggtaaggtc
aggggcaggcatgccgcggccaacttcataataccagccaatacccgattgagcgccagg
atgtcctttcatcgacgcgcgcaaataccagtcaaaagcgcggatatcatcctgctcgac
acccaaccccatcgcatacataacgccaatcaattcttcggcatcggcattgccagaccg
cgccgcaggccacagcgcttcacgtgcctcgacaaatcttccttcttccataaggtcgcg
tgctgcttcgatttcagcatgggcaaagaccggcaggagaactccaacgatcataaacat
cagaaagcgacgcattttaagtcctttgtttttacacttattgccagcatggtttttggg
catgcaacatttgccgaaactactgatttgccgcgaccacttgttgatgccgattttcat
aatattgatgccatgcaagccagtcttggtcaaaagcttttctatgataaaattctgtct
ggaaaccagaatatttcctgcggtacgtgtcatcatcatcgctttggtggctcggatggt
ttgtctttgggtattggtgaagggggtgttggtgtagggccgacacgattgccggggttt
ggcgacaaccgcatcaaaaagcgggtgcctcgcaatgcttcggccttatggaatattggg
gctaaagaagtcagagttctgtttcaggatggccgactttcagtgtctgatgattatgag
aacgggtttaattcaccagccgaagaatggttaccaaacgggctagataccattctggca
gcacaggccattctgcctatgacagcgcaatttgaaatggcaggcaacccaaaggaaaat
gaggttgctggcgcggcccatgaccggattgacgctgtgtggccaatcatcgccaagcgg
gtgcgtattatccctgaatatgggcagctatttgttgacgcgtttgacgatgttgaaacg
gctgatcaagttgatattacgcatattgccaaagcattaggtgcgtttatcggacaggaa
tggcggtcgcatgacagcccgtttgatgcttttatatcaggggataaaaccgcattgaac
gcatcacaaaagcgtggtttggacctgttttatggcaaagctaattgtgccagttgtcat
tcaggctcgcttctgagtgatcacaaattttatgctctggccttgccaccatttggccca
ggacgaacacggcgatttgatccctatgttcgtgatgttggccgcatgggcgaaagcgat
gatctagcagatgcctacagattcaaaaccccacaattgcgtaatgtcgctttgacgggt
ccctatgggcataatggtgcctatgcgtcattggaaaatatggtgcggcatcacctaaac
cccttgcagatgctagatgagtggcaaccggaaatggcgcaattgccaacagctgaatgg
ctacaggcgattgattttgttgtgatgagtgataagcgtgaaatggcaaggcagcgcagc
catctcgatatcacgcccattgacctaaatgaccgtgagattgatgatttggtggcgttt
ctgcatagcttgaccggtgccacagcattgcgtttgccgcttggggttcccgatacggtg
ccaagcggattgccagttgataaataa

DBGET integrated database retrieval system