KEGG   Candidatus Puniceispirillum marinum: SAR116_0410Help
Entry
SAR116_0410       CDS       T01207                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
apb  Candidatus Puniceispirillum marinum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(439141..439779)
Genome map
AA seq 212 aa AA seqDB search
MEDFTQHKAQLIMALRGQGILSATVLSALENIPRELFVPESLHQHAYENASLPIALDQTI
SQPYVVARMTEALELTGRERVLEIGTGSGYQAAILTLLCRRVYTLERLKPLLVTAENKLR
SLRISNISFRLGDGSLGWPEAAPFDRIILTCGCHKIPDKLLNQLKIGGIMVAPEGLGKNQ
QLVVVKRQEAGFERKHLMAVTFVPLIEGKQDE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttggaggatttcacccaacataaggcgcagttaattatggcactgcgagggcaggggatt
cttagcgcaactgtattatcagctctggaaaatataccgcgggaactttttgtccccgaa
tcacttcatcagcatgcctatgaaaatgcatctttgccgatagcgcttgatcagacaata
agccagccttatgtggtcgctcgcatgaccgaggcacttgaattgacgggacgcgaacgc
gtgctcgaaataggaacaggaagtggatatcaggcggcaatcttaaccttattatgtcgt
cgcgtttatacactggaacgtcttaagccgcttttggtgactgctgagaataaattgcga
agcttgcgcatttctaacatcagcttcagattaggtgatggaagtctgggttggcctgaa
gcagcaccctttgaccgcatcattcttacatgcggttgccataaaattcccgacaaactg
ttgaaccaattaaaaattggcggcatcatggtggcacctgaggggttaggaaaaaatcaa
caactcgtggtggtgaaacgtcaagaggctggttttgaacggaaacatctcatggctgtg
acctttgtaccactgattgagggcaaacaggatgaataa

DBGET integrated database retrieval system