KEGG   Candidatus Puniceispirillum marinum: SAR116_0429Help
Entry
SAR116_0429       CDS       T01207                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
apb  Candidatus Puniceispirillum marinum
Brite
Enzymes [BR:apb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SAR116_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_32 MTS Methyltr_RsmB-F Methyltransf_PK Eno-Rase_NADH_b Methyltransf_11 Methyltransf_18 Methyltransf_4 ACP_syn_III_C Glucokinase Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ADE38672
UniProt: D5BQV8
Position
complement(458258..458887)
Genome map
AA seq 209 aa AA seqDB search
MVNCQIRPNKVTDERVLDAFSTIPREAFVAKHQRSIAYIDEDLMLTNGRCLMEPMVLSRL
TQALEIRSDDNVLVVGAGSGYGTAIMAQIAGSVIAIETRTQLVDKAQETLANIGIDNAAF
IKSRLADGYPEEGPYDRIIIEGGVETVPDSLLKQLTPKGRLVAVKRAKNEAVGVACLWTR
AGDNFSYTPLFNAQVPNLDEFNTKVEFVF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggttaattgccaaattaggccaaacaaggttaccgatgaacgtgtgcttgacgccttt
tcgacgataccccgtgaagcctttgtggcgaagcaccagcgctcaattgcctatattgac
gaagatctaatgctgacgaatggtagatgtttgatggaaccaatggttctttcacggctg
actcaagctcttgaaatccggagcgatgataatgttctggttgttggtgctggttcgggc
tatggcacggctataatggcacaaatagcgggttcggtcattgccattgaaacccgcacg
caacttgtagataaagcccaagaaacgctggctaacattggtattgataatgcggccttt
attaagtctcgcctcgctgatggttatcctgaagaaggtccttatgaccgtatcatcatt
gaggggggtgttgaaacagtacctgatagtttactcaagcaactgaccccaaaggggcgt
ctagtggcagttaaacgggctaaaaatgaagctgttggtgtagcctgcctgtggacgcgg
gctggagataacttttcatatacgcccctttttaacgctcaggtgcccaacctagacgag
ttcaacactaaagttgagtttgtcttttaa

DBGET integrated database retrieval system