KEGG   Candidatus Puniceispirillum marinum: SAR116_0438Help
Entry
SAR116_0438       CDS       T01207                                 

Definition
phosphoribosyl-AMP cyclohydrolase HisIE (EC:3.5.4.19 3.6.1.31)
Orthology
K11755  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:apb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(469350..469976)
Genome map
AA seq 208 aa AA seqDB search
MSDAVMINLDAPDWNKDGESGLLPAIIQHVDTREVLMLGYMNRDALAASYDSGKVTFYSR
SKQRLWMKGESSGNILTLIEVKLDCDNDSLLVLASPAGPTCHTGAHSCFGEKTASNTTFL
DRLGIVIKQRHAAMPAGSYTTSLFEAGKARIAQKVGEEGVELALARMKDDKAEMANESAD
LLFHMMVLLEDADLSLADAISVLQDRHK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgcggtcatgatcaatctggatgccccagactggaacaaagatggtgaaagc
ggtttattaccagcgattatccagcatgtagatacgcgcgaagtgttgatgcttggctat
atgaaccgtgacgctctggcggcaagctatgatagcggcaaggtaaccttttatagccgt
tccaagcaacgcctctggatgaaaggtgaaagctcgggtaatatattgacacttattgag
gtcaaacttgattgtgacaatgatagtttgttggttttggcatcaccggctggccccact
tgccatactggtgcgcattcatgctttggtgagaaaacagcatcaaacacgacgtttctt
gaccgccttgggattgtgataaagcaacgtcatgccgctatgccagcaggtagctataca
accagtctgtttgaagctgggaaagcgcgtatcgcacaaaaggttggtgaagagggggtt
gaacttgctctggcccgtatgaaggatgataaggccgaaatggccaatgagtcggcagat
ttgctattccatatgatggtattgctggaagatgctgatttatcactggccgatgcgatt
tctgttttgcaagaccgtcataaataa

DBGET integrated database retrieval system