KEGG   Candidatus Puniceispirillum marinum: SAR116_0438Help
Entry
SAR116_0438       CDS       T01207                                 

Definition
phosphoribosyl-AMP cyclohydrolase HisIE (EC:3.5.4.19 3.6.1.31)
Orthology
K11755  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAR116_0438
  Amino acid metabolism
   00340 Histidine metabolism
    SAR116_0438
Enzymes [BR:apb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     SAR116_0438
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     SAR116_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(469350..469976)
Genome map
AA seq 208 aa AA seqDB search
MSDAVMINLDAPDWNKDGESGLLPAIIQHVDTREVLMLGYMNRDALAASYDSGKVTFYSR
SKQRLWMKGESSGNILTLIEVKLDCDNDSLLVLASPAGPTCHTGAHSCFGEKTASNTTFL
DRLGIVIKQRHAAMPAGSYTTSLFEAGKARIAQKVGEEGVELALARMKDDKAEMANESAD
LLFHMMVLLEDADLSLADAISVLQDRHK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgcggtcatgatcaatctggatgccccagactggaacaaagatggtgaaagc
ggtttattaccagcgattatccagcatgtagatacgcgcgaagtgttgatgcttggctat
atgaaccgtgacgctctggcggcaagctatgatagcggcaaggtaaccttttatagccgt
tccaagcaacgcctctggatgaaaggtgaaagctcgggtaatatattgacacttattgag
gtcaaacttgattgtgacaatgatagtttgttggttttggcatcaccggctggccccact
tgccatactggtgcgcattcatgctttggtgagaaaacagcatcaaacacgacgtttctt
gaccgccttgggattgtgataaagcaacgtcatgccgctatgccagcaggtagctataca
accagtctgtttgaagctgggaaagcgcgtatcgcacaaaaggttggtgaagagggggtt
gaacttgctctggcccgtatgaaggatgataaggccgaaatggccaatgagtcggcagat
ttgctattccatatgatggtattgctggaagatgctgatttatcactggccgatgcgatt
tctgttttgcaagaccgtcataaataa

DBGET integrated database retrieval system