KEGG   Candidatus Puniceispirillum marinum: SAR116_0583Help
Entry
SAR116_0583       CDS       T01207                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
apb  Candidatus Puniceispirillum marinum
Pathway
apb00010  Glycolysis / Gluconeogenesis
apb00052  Galactose metabolism
apb01100  Metabolic pathways
apb01110  Biosynthesis of secondary metabolites
apb01120  Microbial metabolism in diverse environments
apb01130  Biosynthesis of antibiotics
Module
apb_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:apb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR116_0583
   00052 Galactose metabolism
    SAR116_0583
Enzymes [BR:apb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAR116_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADE38826
UniProt: D5BRC9
Position
619041..620039
Genome map
AA seq 332 aa AA seqDB search
MIRSIGISRQNCEVQAIDIWRDGLSATILTWGAVVQDLRLLGHDAPLVLGFRKFKHYPRY
SPYYGAIAGRVANRIANGHGKIGDLSFHSDTNFLGKHSLHGGKDGFGTRDWDIRDHGHDF
VELGLRDPDGMMGFPGALDVTCRYEIQPGNELVVTLDAKTDAPTFCNLAHHSYFCLDDTG
DIRGHELQIHADAYLPCDAEFIPTGEIRDVTDTSYDFRTVRLIGACDPCAYDVNYCLGTS
KVPIRPVATVKSPHSGIMMQVASTEPGLQLYTGHKLGPPVPGLNGRLNGPYSGLCLEPQL
WPDAPNHPHFPSISLYPDTHYHQKSSFTFAVT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcagatctatcggtatttcccgtcaaaattgtgaagttcaagcgattgatatatgg
cgagacgggctttcggcaacgattctgacatggggcgcagtggttcaggatttacgccta
ttgggccatgacgcgcctttggtgttggggtttcgcaagttcaaacattatcctcgttat
tcgccgtattatggagccatagctggacgcgttgccaatcgcattgctaacggacatgga
aaaattggtgatctgagctttcacagcgataccaattttctgggcaagcatagtcttcat
ggcggcaaagatggctttggcacccgtgactgggacattcgcgatcatggacatgatttt
gttgaactgggcttgcgtgatcccgacggcatgatgggctttcctggcgcacttgacgtc
acctgccgttatgaaattcagcctggcaatgagctggtcgtaacgcttgatgcaaaaacc
gacgcgcccaccttttgtaatctggcacatcatagttatttctgtcttgatgataccgga
gacattcgcgggcatgaattacaaattcatgctgacgcctatttaccttgtgacgcggaa
tttattccgacaggtgaaatacgtgatgtcaccgacaccagttatgattttcgcacggta
cgactgattggcgcttgtgatccttgcgcctatgatgtcaattactgccttggcaccagc
aaggtgccgatccgacccgtagccactgtgaaaagcccgcattcgggtattatgatgcag
gtggctagcactgagcccggacttcagctatacactggacataagctcggcccgccggtt
cccggattgaacggtcggctgaatggcccctattcggggctttgtcttgaaccgcaatta
tggccggatgcgccaaaccacccccattttccgtcaatttcactttatcccgatactcat
tatcaccagaaaagtagtttcactttcgctgttacttaa

DBGET integrated database retrieval system